📚 node [[ ..]]

Welcome! Nobody has contributed anything to ' ..' yet. You can:

Write something in the document below!
- There is at least one public document in every node in the Agora. Whatever you write in it will be integrated and made available for the next visitor to read and edit.
Write to the Agora from social media.
- If you follow Agora bot on a supported platform and include the wikilink [[ ..]] in a post, the Agora will link it here and optionally integrate your writing.
Sign up as a full Agora user.
- As a full user you will be able to contribute your personal notes and resources directly to this knowledge commons. Some setup required :)

⥅ related node [[agora repository]]

⥅ related node [[agora2]]

⥅ related node [[contract]]

⥅ related node [[distributed knowledge graph]]

⥅ related node [[foam]]

⥅ related node [[howto]]

⥅ related node [[experimental social network]]

⥅ related node [[after it install]]

⥅ related node [[ankostis]]

⥅ related node [[ankostis urls]]

⥅ related node [[foam icon]]

⥅ related node [[gafam]]

⥅ related node [[gnu manifesto comic]]

⥅ related node [[hypertext 1963]]

⥅ related node [[hypertext]]

⥅ related node [[internet map]]

⥅ related node [[ipfs logo]]

⥅ related node [[kids breadcrumbs]]

⥅ related node [[nym logo]]

⥅ related node [[occupy github]]

⥅ related node [[rms]]

⥅ related node [[tednelson xanadu]]

⥅ related node [[wikipedia editors]]

⥅ related node [[wikipedia in a tablet]]

⥅ related node [[englishisms]]

⥅ related node [[freedom]]

⥅ related node [[gifts]]

⥅ related node [[history]]

⥅ related node [[home assistant]]

⥅ related node [[hypothesis]]

⥅ related node [[inbox]]

⥅ related node [[index]]

⥅ related node [[dice design]]

⥅ related node [[kubernetes jrc training]]

⥅ related node [[kialo]]

⥅ related node [[mobile phone offers]]

⥅ related node [[my androids]]

⥅ related node [[my pc]]

⥅ related node [[my raspi]]

⥅ related node [[phaos]]

⥅ related node [[pkdb]]

⥅ related node [[programming ideas]]

⥅ related node [[promnesia]]

⥅ related node [[readme]]

⥅ related node [[shopping]]

⥅ related node [[sto kokkino]]

⥅ related node [[tags]]

⥅ related node [[todo]]

⥅ related node [[επικήδειος χρήστου]]

⥅ related node [[january 3rd 2021]]

⥅ related node [[nixery]]

⥅ related node [[2020 11 15]]

⥅ related node [[roam2agora]]

⥅ related node [[test public page]]

⥅ related node [[a “short list” of books that were recommended to zefrank]]

⥅ related node [[alternative user interfaces]]

⥅ related node [[ask yourself these 6 questions]]

⥅ related node [[baader meinhof phenomenon]]

⥅ related node [[bbchase]]

⥅ related node [[10 happier]]

⥅ related node [[1984]]

⥅ related node [[a people s history of the united states]]

⥅ related node [[animal farm]]

⥅ related node [[bad feminist]]

⥅ related node [[before and after getting your puppy]]

⥅ related node [[bird by bird]]

⥅ related node [[boundaries]]

⥅ related node [[captive audience]]

⥅ related node [[crypto]]

⥅ related node [[digital minimalism]]

⥅ related node [[ergodicity (book)]]

⥅ related node [[fiber]]

⥅ related node [[foundation]]

⥅ related node [[furiously happy]]

⥅ related node [[getting things done]]

⥅ related node [[god]]

⥅ related node [[good and mad]]

⥅ related node [[good omens]]

⥅ related node [[how to be an antiracist]]

⥅ related node [[how to skimm your life]]

⥅ related node [[how to take smart notes]]

⥅ related node [[hyperbole and a half]]

⥅ related node [[i am a strange loop]]

⥅ related node [[i will teach you to be rich]]

⥅ related node [[it doesn t have to be crazy at work]]

⥅ related node [[it s all too much]]

⥅ related node [[jurassic park]]

⥅ related node [[maddaddam]]

⥅ related node [[manage your day to day]]

⥅ related node [[managing humans]]

⥅ related node [[mind management not time management]]

⥅ related node [[mindfulness made simple]]

⥅ related node [[mindfulness meditation]]

⥅ related node [[nonviolent communication]]

⥅ related node [[nurtureshock]]

⥅ related node [[one nation under god]]

⥅ related node [[organized mind]]

⥅ related node [[oryx and crake]]

⥅ related node [[people centric security transforming your enterprise security culture]]

⥅ related node [[planning for ipv6]]

⥅ related node [[politics from a to z]]

⥅ related node [[religion for atheists]]

⥅ related node [[remote]]

⥅ related node [[rework]]

⥅ related node [[slaughterhouse five]]

⥅ related node [[snow crash]]

⥅ related node [[so good they can t ignore you]]

⥅ related node [[ten arguments for deleting your social media accounts right now]]

⥅ related node [[the amber spyglass]]

⥅ related node [[the art of thinking in systems]]

⥅ related node [[the better angels of our nature]]

⥅ related node [[the code book]]

⥅ related node [[the complacent class]]

⥅ related node [[the consulting bible]]

⥅ related node [[the design of everyday things]]

⥅ related node [[the diamond age]]

⥅ related node [[the dictator s handbook]]

⥅ related node [[the first bad man]]

⥅ related node [[the foa reference guide to fiber optic network design]]

⥅ related node [[the golden compass]]

⥅ related node [[the handmaid s tale]]

⥅ related node [[the happiness trap]]

⥅ related node [[the internet of very small computers masquerading as things]]

⥅ related node [[the luminaries]]

⥅ related node [[the manual]]

⥅ related node [[the martian]]

⥅ related node [[the meditations]]

⥅ related node [[the mindful way through depression]]

⥅ related node [[the nature fix]]

⥅ related node [[the new urban crisis]]

⥅ related node [[the ocean at the end of the lane]]

⥅ related node [[the power of when]]

⥅ related node [[the productivity project]]

⥅ related node [[the responsive city]]

⥅ related node [[the shallows]]

⥅ related node [[the view from flyover country]]

⥅ related node [[the year of less]]

⥅ related node [[the year of the flood]]

⥅ related node [[think better]]

⥅ related node [[time and how to spend it 2]]

⥅ related node [[time and how to spend it]]

⥅ related node [[triggers]]

⥅ related node [[undoing depression]]

⥅ related node [[we should all be feminists]]

⥅ related node [[where wizards stay up late]]

⥅ related node [[wherever you go there you are]]

⥅ related node [[winners take all]]

⥅ related node [[you are among friends]]

⥅ related node [[zealot]]

⥅ related node [[zen and the art of motorcycle maintenance]]

⥅ related node [[canceling contrapoints]]

⥅ related node [[caring for your introvert]]

⥅ related node [[coffee alternatives]]

⥅ related node [[devonthink]]

⥅ related node [[digital gardens]]

⥅ related node [[evergreen upgrade advice]]

⥅ related node [[expanding volumes on centos]]

⥅ related node [[gtd incompletion triggers]]

⥅ related node [[how millennials became the burnout generation]]

⥅ related node [[infp organizing profile your organizing business]]

⥅ related node [[laziness does not exist]]

⥅ related node [[how many ipv6 nodes can you have on a lan?]]

⥅ related node [[life as an ipv6 technology laggard]]

⥅ related node [[ospf]]

⥅ related node [[rina]]

⥅ related node [[routing protocol]]

⥅ related node [[routing tcp ip volume 1]]

⥅ related node [[sdn software defined networks]]

⥅ related node [[the 2014 internet peering playbook]]

⥅ related node [[the art of network architecture]]

⥅ related node [[note and research apps 2]]

⥅ related node [[note and research apps]]

⥅ related node [[obsidian resources]]

⥅ related node [[obsidian wish list]]

⥅ related node [[para]]

⥅ related node [[quit your phone addiction using methods that work for smokers]]

⥅ related node [[great books bookmark]]

⥅ related node [[quotes from evernote]]

⥅ related node [[quotes from getpocket com]]

⥅ related node [[we must not be too hasty in mocking aristotle’s prejudices]]

⥅ related node [[with the first link the chain is forged]]

⥅ related node [[show hidden files in finder]]

⥅ related node [[static site generators]]

⥅ related node [[strengths finder 2 0]]

⥅ related node [[studies shoot down tech’s harmful effects on kids—so now what?]]

⥅ related node [[the 6 month mark in any sustained crisis]]

⥅ related node [[the show with [[zefrank]]]]

⥅ related node [[the social dilemma]]

⥅ related node [[think of it like this we are a product experience team]]

⥅ related node [[bad actors are not sufficiently penalised]]

⥅ related node [[tweets from jj 「cιtιƶεɳƒιvε」 🏴‍☠️]]

⥅ related node [[tweets from juvoni beckford]]

⥅ related node [[tweets from visa]]

⥅ related node [[why walkable cities are good for the economy according to a city planner]]

⥅ related node [[wikihistory]]

⥅ related node [[zefrank]]

⥅ related node [[2 minute new habit]]

⥅ related node [[6 principles of persuasion]]

⥅ related node [[a brief history & ethos of the digital garden]]

⥅ related node [[absorbing a book]]

⥅ related node [[acknoledge the root of distration]]

⥅ related node [[adam smith grandfather of economics]]

⥅ related node [[addiction assessment]]

⥅ related node [[albert camus]]

⥅ related node [[allergy intolerance]]

⥅ related node [[apophenia]]

⥅ related node [[arete]]

⥅ related node [[aristotle]]

⥅ related node [[attention is your scarcest resource]]

⥅ related node [[authentic listening]]

⥅ related node [[behavior triggers]]

⥅ related node [[belief threshold]]

⥅ related node [[bill and malinda gates foundation letter]]

⥅ related node [[book flow by mihaly csikszentmihalyi]]

⥅ related node [[brain changes in addiction]]

⥅ related node [[building rapport]]

⥅ related node [[bullshit filters]]

⥅ related node [[cal newport "so good they can t ignore you"]]

⥅ related node [[capture understanding don t quote]]

⥅ related node [[change management]]

⥅ related node [[change story]]

⥅ related node [[child rights]]

⥅ related node [[coaching]]

⥅ related node [[code is harder to read than it is to write]]

⥅ related node [[cognitive dissonance]]

⥅ related node [[conceptual metaphor theory]]

⥅ related node [[confirmation bias]]

⥅ related node [[connections in people groups]]

⥅ related node [[consciousness can t be physical]]

⥅ related node [[control theory]]

⥅ related node [[controlling emotions vs controlling behaviour]]

⥅ related node [[cost of mistrust]]

⥅ related node [[curiosity not passion]]

⥅ related node [[deep work and 30 hour method]]

⥅ related node [[deep work]]

⥅ related node [[default mode network on drugs]]

⥅ related node [[difference in classical and operant conditioning]]

⥅ related node [[different types of notes in zettelkasten]]

⥅ related node [[documentation framework]]

⥅ related node [[dopamine s function creating the want]]

⥅ related node [[dunning–kruger effect]]

⥅ related node [[ego defense]]

⥅ related node [[ego depletion]]

⥅ related node [[eigenquestions art of framing problems]]

⥅ related node [[eiqenqestion in framing problems]]

⥅ related node [[embodied cognition]]

⥅ related node [[embodiment and human nature]]

⥅ related node [[empapthy]]

⥅ related node [[employees who feel love perform better]]

⥅ related node [[empowering self transactional analysis 101]]

⥅ related node [[equanimity is freedom]]

⥅ related node [[equanimity meditation last of the brahmaviharas]]

⥅ related node [[eudaimonia]]

⥅ related node [[execute by delay]]

⥅ related node [[existential psychotherapy]]

⥅ related node [[existential psycological disorders]]

⥅ related node [[existentialism lecture by daniel bonevac]]

⥅ related node [[existentialism]]

⥅ related node [[existentialism main features]]

⥅ related node [[facticity and trancendence]]

⥅ related node [[faith programming in brain]]

⥅ related node [[feelings are noisy signals]]

⥅ related node [[fixed vs growth mindset]]

⥅ related node [[flow state]]

⥅ related node [[flow theory]]

⥅ related node [[franz kafka]]

⥅ related node [[fredrich nietzsche]]

⥅ related node [[friedrich nietzsche become superhuman]]

⥅ related node [[fyodor dostoyevsky]]

⥅ related node [[has science made religion useless?]]

⥅ related node [[heidegger]]

⥅ related node [[how i read books a guide on how to learn]]

⥅ related node [[how social media changed communication]]

⥅ related node [[how to empower others 1]]

⥅ related node [[how to empower others 2]]

⥅ related node [[how to empower others 3]]

⥅ related node [[how to empower others 4]]

⥅ related node [[how to take smart notes talk by sonke ahrens]]

⥅ related node [[human needs]]

⥅ related node [[identity created from suffering]]

⥅ related node [[impact of metaphor thinking]]

⥅ related node [[imposter syndrome]]

⥅ related node [[influence model]]

⥅ related node [[insights with psychedelic or mystical experiences]]

⥅ related node [[integrity]]

⥅ related node [[interactive group effect]]

⥅ related node [[intro to notion]]

⥅ related node [[introduction to existentialism]]

⥅ related node [[introduction to philosophy]]

⥅ related node [[jean paul sartre]]

⥅ related node [[keep identity small]]

⥅ related node [[keyfabe]]

⥅ related node [[majority illusion]]

⥅ related node [[manage your energy not your time]]

⥅ related node [[map vs territory]]

⥅ related node [[mastery by discovery]]

⥅ related node [[memory filters]]

⥅ related node [[mere exposure effect]]

⥅ related node [[mind wandering]]

⥅ related node [[motivated reasoning]]

⥅ related node [[motivational interview]]

⥅ related node [[motivational interviewing]]

⥅ related node [[neuro linguistic programming]]

⥅ related node [[non violent communication nvc]]

⥅ related node [[non violent communication]]

⥅ related node [[notes from session actions against anxiety]]

⥅ related node [[organize your knowledge with zettelkasten]]

⥅ related node [[paraphrasing to remember]]

⥅ related node [[parasocial interation]]

⥅ related node [[permanent notes in zettelkasten]]

⥅ related node [[pertinent negative]]

⥅ related node [[post truth]]

⥅ related node [[power of asking]]

⥅ related node [[power of gentleness]]

⥅ related node [[procrastination behavior]]

⥅ related node [[promise modal of mindfulness meditation]]

⥅ related node [[pseudo sets behaviour push]]

⥅ related node [[psychedelics are fueling a mental health revolution]]

⥅ related node [[psychedelics the scientific renaissance of mind altering drugs]]

⥅ related node [[re framing]]

⥅ related node [[reading and learning]]

⥅ related node [[religion is nature s antidepressant]]

⥅ related node [[replication crisis]]

⥅ related node [[rules of risk]]

⥅ related node [[rules to improve your writing]]

⥅ related node [[satisfiers of human needs]]

⥅ related node [[self determination theory]]

⥅ related node [[semantic versioning]]

⥅ related node [[shorting the market]]

⥅ related node [[social aspect of belief]]

⥅ related node [[soren kierkegaard]]

⥅ related node [[standup content creation]]

⥅ related node [[story structure]]

⥅ related node [[suprise]]

⥅ related node [[surgery the ultimate placebo]]

⥅ related node [[systems thinking intro]]

⥅ related node [[ta adult state]]

⥅ related node [[ta child state]]

⥅ related node [[ta drivers]]

⥅ related node [[ta ego states]]

⥅ related node [[ta injunctions]]

⥅ related node [[ta life positions]]

⥅ related node [[ta life script]]

⥅ related node [[ta parent state]]

⥅ related node [[ta stroke economy]]

⥅ related node [[ta stroke]]

⥅ related node [[ta time structuring]]

⥅ related node [[tableofcontents]]

⥅ related node [[tech centers]]

⥅ related node [[tendency for interpersonal victimhood]]

⥅ related node [[the philosophy of albert camus]]

⥅ related node [[the righteous mind by jonathan haidt]]

⥅ related node [[the zettelkasten method]]

⥅ related node [[thinking in zettelkasten]]

⥅ related node [[this wiki uses google analytics]]

⥅ related node [[transactional analysis]]

⥅ related node [[transformational leadership]]

⥅ related node [[ugh fields]]

⥅ related node [[unsolvable problem can be overcome]]

⥅ related node [[virtual conference best practices]]

⥅ related node [[what boredom says]]

⥅ related node [[what is a goal]]

⥅ related node [[women who never married or had children]]

⥅ related node [[zeigarnik effect]]

⥅ related node [[zettelkasten learning method]]

⥅ related node [[zettelkasten]]

⥅ related node [[2021 06 15 building software together]]

⥅ related node [[2021 02 22]]

⥅ related node [[2021 02 23]]

⥅ related node [[2021 02 24]]

⥅ related node [[2021 02 25]]

⥅ related node [[2021 02 26]]

⥅ related node [[2021 02 27]]

⥅ related node [[2021 02 28]]

⥅ related node [[2021 03 01]]

⥅ related node [[2021 03 02]]

⥅ related node [[2021 03 03]]

⥅ related node [[2021 03 04]]

⥅ related node [[2021 03 05]]

⥅ related node [[2021 03 06]]

⥅ related node [[2021 03 07]]

⥅ related node [[2021 03 08]]

⥅ related node [[2021 03 09]]

⥅ related node [[2021 03 11]]

⥅ related node [[2021 03 12]]

⥅ related node [[2021 03 13]]

⥅ related node [[2021 03 14]]

⥅ related node [[2021 03 15]]

⥅ related node [[2021 03 18]]

⥅ related node [[2021 03 19]]

⥅ related node [[2021 03 20]]

⥅ related node [[2021 03 21]]

⥅ related node [[2021 03 22]]

⥅ related node [[2021 03 23]]

⥅ related node [[2021 03 24]]

⥅ related node [[2021 03 25]]

⥅ related node [[2021 03 27]]

⥅ related node [[2021 03 28]]

⥅ related node [[2021 03 30]]

⥅ related node [[2021 04 05]]

⥅ related node [[2021 04 07]]

⥅ related node [[2021 04 20]]

⥅ related node [[2021 04 24]]

⥅ related node [[2021 04 25]]

⥅ related node [[2021 06 21]]

⥅ related node [[2020 09 01 journal]]

⥅ related node [[2020 09 22 journal]]

⥅ related node [[2020 09 24 journal]]

⥅ related node [[2020 09 25 journal]]

⥅ related node [[2020 09 26 journal]]

⥅ related node [[2020 09 27 journal]]

⥅ related node [[2020 09 28 journal]]

⥅ related node [[2020 09 30 journal]]

⥅ related node [[2020 10 01 journal]]

⥅ related node [[2020 10 03 journal]]

⥅ related node [[2020 10 05 journal]]

⥅ related node [[2020 10 08 journal]]

⥅ related node [[2020 10 10 journal]]

⥅ related node [[2020 10 11 journal]]

⥅ related node [[2020 10 13 journal]]

⥅ related node [[2020 11 07 journal]]

⥅ related node [[2020 11 08 journal]]

⥅ related node [[2020 11 14 journal]]

⥅ related node [[2020 11 20 journal]]

⥅ related node [[2020 11 24 journal]]

⥅ related node [[2020 11 27 journal]]

⥅ related node [[2020 11 28 journal]]

⥅ related node [[2020 11 29 journal]]

⥅ related node [[2020 12 05 journal]]

⥅ related node [[2020 12 06 journal]]

⥅ related node [[2020 12 19 journal]]

⥅ related node [[2020 12 29 01]]

⥅ related node [[2020 12 29 02]]

⥅ related node [[2020 12 29 03]]

⥅ related node [[2021 01 10 13]]

⥅ related node [[2021 01 10 14]]

⥅ related node [[2021 01 10 journal]]

⥅ related node [[2021 01 24 journal]]

⥅ related node [[2021 02 09 journal]]

⥅ related node [[2021 02 13 journal]]

⥅ related node [[2021 02 14 journal]]

⥅ related node [[2021 02 20 indiekit articles notes]]

⥅ related node [[2021 02 20 indiekit]]

⥅ related node [[2021 02 20 openfaas]]

⥅ related node [[20210220 0628]]

⥅ related node [[20210221 0827]]

⥅ related node [[20210221 0834]]

⥅ related node [[20210221 0837]]

⥅ related node [[20210221 2122]]

⥅ related node [[20210221 2241]]

⥅ related node [[20210222 0628]]

⥅ related node [[12 factor apps]]

⥅ related node [[2019]]

⥅ related node [[a_new_open_source_deal_for_web3]]

⥅ related node [[about]]

⥅ related node [[age encryption]]

⥅ related node [[agentofuser]]

⥅ related node [[agora faq]]

⥅ related node [[agora]]

⥅ related node [[algolia electron internal]]

⥅ related node [[allthebestrecipes]]

⥅ related node [[anagora]]

⥅ related node [[anil dash yes code]]

⥅ related node [[anil dash]]

⥅ related node [[astuto]]

⥅ related node [[asus vg289q]]

⥅ related node [[athens]]

⥅ related node [[backlinks]]

⥅ related node [[beipa]]

⥅ related node [[bigfootjs]]

⥅ related node [[blink]]

⥅ related node [[blog colophon]]

⥅ related node [[blot im]]

⥅ related node [[bvp roadmap opensource]]

⥅ related node [[calibre]]

⥅ related node [[camo]]

⥅ related node [[canadian incorporation setup non resident]]

⥅ related node [[cantrust]]

⥅ related node [[cap table learning]]

⥅ related node [[cheat]]

⥅ related node [[chezmoi]]

⥅ related node [[chicken fingers vs tentacles]]

⥅ related node [[chromebook]]

⥅ related node [[chromebrew]]

⥅ related node [[chromeos]]

⥅ related node [[cli]]

⥅ related node [[cloud gaming chromebook]]

⥅ related node [[cloudflare ipfs gateway]]

⥅ related node [[clt vancouver]]

⥅ related node [[clubhouse]]

⥅ related node [[cobuilding]]

⥅ related node [[cobuying property with friends]]

⥅ related node [[colophon]]

⥅ related node [[come for network pay for tool]]

⥅ related node [[connecting to the agora]]

⥅ related node [[contact]]

⥅ related node [[custom bags in vancouver]]

⥅ related node [[dbt]]

⥅ related node [[dealing with employees and politics]]

⥅ related node [[decentralized social ecosystem review]]

⥅ related node [[decentralized social media internet archive]]

⥅ related node [[democracy sovereignty bianca wylie]]

⥅ related node [[deploy to heroku]]

⥅ related node [[digital garden jekyll template]]

⥅ related node [[discord]]

⥅ related node [[discourse]]

⥅ related node [[dnsrecords]]

⥅ related node [[do nix server]]

⥅ related node [[dotfiles]]

⥅ related node [[drupal decentralized web drupalcon]]

⥅ related node [[duckramenwiki]]

⥅ related node [[efounders startup studio financing]]

⥅ related node [[egpu]]

⥅ related node [[ehlist]]

⥅ related node [[embassy network]]

⥅ related node [[emerge]]

⥅ related node [[faasd]]

⥅ related node [[features of simply jekyll]]

⥅ related node [[fedstoa]]

⥅ related node [[fifth generation management]]

⥅ related node [[filecoin]]

⥅ related node [[fission publish]]

⥅ related node [[fission]]

⥅ related node [[forward email]]

⥅ related node [[fraidycat]]

⥅ related node [[frontity]]

⥅ related node [[garden and the gazebo]]

⥅ related node [[ghost]]

⥅ related node [[git bug]]

⥅ related node [[git siphon for moa party]]

⥅ related node [[git]]

⥅ related node [[githawk]]

⥅ related node [[github actions for jekyll]]

⥅ related node [[gitlab]]

⥅ related node [[glitch]]

⥅ related node [[goggles]]

⥅ related node [[googlesheets]]

⥅ related node [[graph]]

⥅ related node [[gumroad shl part time work]]

⥅ related node [[haskell]]

⥅ related node [[heroku]]

⥅ related node [[how to build a business]]

⥅ related node [[how to setup simply jekyll]]

⥅ related node [[how to use simple jekyll]]

⥅ related node [[humane representation of thought bret victor]]

⥅ related node [[hyper terminal]]

⥅ related node [[i ran lsn]]

⥅ related node [[iawriter]]

⥅ related node [[implementing littlefoot for footnotes]]

⥅ related node [[indieauth]]

⥅ related node [[indiekit]]

⥅ related node [[indieweb]]

⥅ related node [[intro to simple jekyll]]

⥅ related node [[ipfs chromeos]]

⥅ related node [[ipfs deploy]]

⥅ related node [[ipfs]]

⥅ related node [[jacobsayles]]

⥅ related node [[jam]]

⥅ related node [[jay graber]]

⥅ related node [[jekyll]]

⥅ related node [[joplin]]

⥅ related node [[julian lehr]]

⥅ related node [[liberapay]]

⥅ related node [[licensing]]

⥅ related node [[littlefoot]]

⥅ related node [[livegrep]]

⥅ related node [[logseq]]

⥅ related node [[macmini]]

⥅ related node [[mailtrain]]

⥅ related node [[marfa theme]]

⥅ related node [[markdown notes]]

⥅ related node [[mastodon]]

⥅ related node [[maxime vaillancourt]]

⥅ related node [[meet coop]]

⥅ related node [[memoryexpress]]

⥅ related node [[mhawksey twitter archive github pages]]

⥅ related node [[micro editor]]

⥅ related node [[microblog]]

⥅ related node [[micropub to github]]

⥅ related node [[micropub]]

⥅ related node [[minimal mistakes]]

⥅ related node [[mit license]]

⥅ related node [[mit]]

⥅ related node [[moa party]]

⥅ related node [[multipass vm]]

⥅ related node [[neocities]]

⥅ related node [[networked notebooks catalogue]]

⥅ related node [[neuron]]

⥅ related node [[nfx viral network]]

⥅ related node [[nixos]]

⥅ related node [[notes meta layer julianlehr]]

⥅ related node [[notist]]

⥅ related node [[obsidian]]

⥅ related node [[office space vancouver]]

⥅ related node [[open collective]]

⥅ related node [[orbit model]]

⥅ related node [[orbit]]

⥅ related node [[orientation]]

⥅ related node [[osx]]

⥅ related node [[outline]]

⥅ related node [[overton window]]

⥅ related node [[photopea]]

⥅ related node [[pingly email chat]]

⥅ related node [[pioneers settlers townplanners]]

⥅ related node [[piratemetrics]]

⥅ related node [[pitchdeck]]

⥅ related node [[pkgsrc]]

⥅ related node [[platform economies alihamed]]

⥅ related node [[posthog]]

⥅ related node [[presentations]]

⥅ related node [[processing]]

⥅ related node [[productmetrics]]

⥅ related node [[projects]]

⥅ related node [[prosemirror]]

⥅ related node [[pull github app]]

⥅ related node [[razer core x chroma]]

⥅ related node [[recommended]]

⥅ related node [[remailable]]

⥅ related node [[remarkable]]

⥅ related node [[roam research]]

⥅ related node [[s3 ios app]]

⥅ related node [[s3]]

⥅ related node [[s3_email]]

⥅ related node [[secondbrain]]

⥅ related node [[send in blue email]]

⥅ related node [[sillygwailo]]

⥅ related node [[simon wardley]]

⥅ related node [[simply jekyll markdown test]]

⥅ related node [[simply jekyll template]]

⥅ related node [[simply jekyll]]

⥅ related node [[slicing pie]]

⥅ related node [[smb peers]]

⥅ related node [[social coop]]

⥅ related node [[social mentions]]

⥅ related node [[software]]

⥅ related node [[speakerdeck]]

⥅ related node [[stack software sovereignty]]

⥅ related node [[standard readme]]

⥅ related node [[startup]]

⥅ related node [[startupstudio]]

⥅ related node [[subscribe]]

⥅ related node [[substack]]

⥅ related node [[tailwinds vanish]]

⥅ related node [[twitter archive]]

⥅ related node [[typesense recipe search]]

⥅ related node [[ubuntu]]

⥅ related node [[vancouver local makers directory]]

⥅ related node [[vancouver]]

⥅ related node [[venturescouts]]

⥅ related node [[vgr]]

⥅ related node [[viznut eternal september]]

⥅ related node [[vnotes format]]

⥅ related node [[vyper chromeos]]

⥅ related node [[walletconf]]

⥅ related node [[wardley maps]]

⥅ related node [[web annotation standard]]

⥅ related node [[webfeeds]]

⥅ related node [[webmention]]

⥅ related node [[weserv]]

⥅ related node [[wget]]

⥅ related node [[what investors want]]

⥅ related node [[wiki]]

⥅ related node [[wikijs]]

⥅ related node [[wip]]

⥅ related node [[worklog]]

⥅ related node [[xodo pdf reader]]

⥅ related node [[yearlog]]

⥅ related node [[zoom]]

⥅ related node [[2002 11 09 welcome to b mann consulting]]

⥅ related node [[2002 11 29 dream cms]]

⥅ related node [[2002 12 03 50 places to see before you die]]

⥅ related node [[2002 12 03 configuration configuration configuration]]

⥅ related node [[2002 12 05 home server woes]]

⥅ related node [[2002 12 09 no more woes]]

⥅ related node [[2002 12 14 building 1200 pc vs 2500 pc]]

⥅ related node [[2002 12 19 bmc goes table less]]

⥅ related node [[2002 12 19 lotr the two towers]]

⥅ related node [[2002 12 19 peasants placated peons pave poppies]]

⥅ related node [[2002 12 21 enabling anonymous ftp]]

⥅ related node [[2002 12 21 instructions for pre 10 2 systems]]

⥅ related node [[2002 12 22 linux falling into same trap a call for innovation]]

⥅ related node [[2002 12 23 boxes and arrows beauty is only screen deep sarah horton]]

⥅ related node [[2002 12 23 digitalmass mitch kapor and chandler vs ms outlook]]

⥅ related node [[2002 12 23 osx at freshmeat]]

⥅ related node [[2002 12 23 plone]]

⥅ related node [[2002 12 23 the register microsoft to acquire macromedia]]

⥅ related node [[2003 01 07 macworld wants your ilife]]

⥅ related node [[2003 01 11 hunting with bungalow bill]]

⥅ related node [[2003 01 11 leftover turkey]]

⥅ related node [[2003 01 17 laser squad nemesis]]

⥅ related node [[2003 01 19 netnewswire]]

⥅ related node [[2003 01 21 emila]]

⥅ related node [[2003 01 23 helloworld]]

⥅ related node [[2003 01 23 instructions for 10 2 x jaguar]]

⥅ related node [[2003 01 23 mitel sme server 5 6 developer release]]

⥅ related node [[2003 01 23 php collab]]

⥅ related node [[2003 01 23 the inside mac]]

⥅ related node [[2003 01 26 new theme]]

⥅ related node [[2003 01 26 youve got desktops]]

⥅ related node [[2003 01 27 skating on the rideau canal]]

⥅ related node [[2003 01 28 dave hyatts blog more thoughts on rss]]

⥅ related node [[2003 01 28 osopinion lindows media center takes on xp counterpart]]

⥅ related node [[2003 01 28 voip presence system]]

⥅ related node [[2003 02 02 entering my first blog]]

⥅ related node [[2003 02 05 nokia intros phone game music device]]

⥅ related node [[2003 02 05 other interesting osx apps]]

⥅ related node [[2003 02 06 amd 2500]]

⥅ related node [[2003 02 06 good deals of the week]]

⥅ related node [[2003 02 10 the power of apple rendesvous]]

⥅ related node [[2003 02 11 iphoto and gallery integration]]

⥅ related node [[2003 02 11 more browser competition on os x]]

⥅ related node [[2003 02 15 brad delongs notes on larry page google talk]]

⥅ related node [[2003 02 16 bloogle the end of blogging]]

⥅ related node [[2003 02 17 the ultimate mmorpg]]

⥅ related node [[2003 02 19 first day with a 12 powerbook]]

⥅ related node [[2003 02 19 microsoft to buy connectix]]

⥅ related node [[2003 02 19 picklecatz play zaphods get featured in the ottawa sun]]

⥅ related node [[2003 02 19 yay browser pdf plug in]]

⥅ related node [[2003 02 20 6 square pc cube]]

⥅ related node [[2003 02 20 bios no more]]

⥅ related node [[2003 02 21 jon udell on xdocs infopath]]

⥅ related node [[2003 02 21 the state of linux]]

⥅ related node [[2003 02 22 happy birthday boris]]

⥅ related node [[2003 02 22 new cellphone]]

⥅ related node [[2003 02 22 remote desktop connection for mac os x]]

⥅ related node [[2003 02 24 safari sends user info to apple]]

⥅ related node [[2003 02 25 boot and fix over net]]

⥅ related node [[2003 02 26 adobe uses qt to develop new application]]

⥅ related node [[2003 02 26 rebuilding a working imac]]

⥅ related node [[2003 02 27 loosely joining across borders]]

⥅ related node [[2003 02 27 new details emerge on powerpc 970]]

⥅ related node [[2003 02 28 au rendezvous mail and more]]

⥅ related node [[2003 02 28 laughingmeme rssifying the mailing list an update]]

⥅ related node [[2003 02 28 smithdm3 is g 2 g]]

⥅ related node [[2003 03 01 online recipes]]

⥅ related node [[2003 03 04 apple to launch online music service]]

⥅ related node [[2003 03 05 feedreader]]

⥅ related node [[2003 03 06 flipping the relationship gpu becomes cpu]]

⥅ related node [[2003 03 08 bingo]]

⥅ related node [[2003 03 08 in a sunburned country]]

⥅ related node [[2003 03 08 the tivo of audio]]

⥅ related node [[2003 03 10 identifying anonymous posts]]

⥅ related node [[2003 03 10 now for wrath now for ruin and the redeye dawn]]

⥅ related node [[2003 03 10 tux adventure and ribs]]

⥅ related node [[2003 03 11 costik a specter is haunting gaming]]

⥅ related node [[2003 03 12 osopinion the ultimate lock in]]

⥅ related node [[2003 03 12 vonage digital voice phone service]]

⥅ related node [[2003 03 13 sony wifi in a memorystick]]

⥅ related node [[2003 03 13 weather block]]

⥅ related node [[2003 03 14 mini pc mini hi fi look]]

⥅ related node [[2003 03 14 nortel ians rejoice]]

⥅ related node [[2003 03 16 blog bundle]]

⥅ related node [[2003 03 16 critical section i am an iterator]]

⥅ related node [[2003 03 16 rss aggregator with trust experience]]

⥅ related node [[2003 03 16 spaces]]

⥅ related node [[2003 03 17 mipod]]

⥅ related node [[2003 03 17 that thing apple do]]

⥅ related node [[2003 03 18 apple hot downloads x11 public beta 3]]

⥅ related node [[2003 03 18 salon the legend of m u l e]]

⥅ related node [[2003 03 18 snigger]]

⥅ related node [[2003 03 20 son of weather block and personal page]]

⥅ related node [[2003 03 21 get your war on]]

⥅ related node [[2003 03 21 sonicblue go bye bye]]

⥅ related node [[2003 03 22 mac to pc filesharing]]

⥅ related node [[2003 03 22 todd asks what pda should i buy]]

⥅ related node [[2003 03 27 simple clustering with xserve]]

⥅ related node [[2003 04 02 blogchalking]]

⥅ related node [[2003 04 02 games as collectors items]]

⥅ related node [[2003 04 03 ars technica about the finder]]

⥅ related node [[2003 04 15 extremetech linux media jukebox]]

⥅ related node [[2003 04 15 safari beta2 tabs and more]]

⥅ related node [[2003 04 18 ambigious org sikander and wheres willy]]

⥅ related node [[2003 04 20 back to building multimedia pcs]]

⥅ related node [[2003 04 20 scobleizer yaamr]]

⥅ related node [[2003 04 21 ps3 chip to be 1 teraflop]]

⥅ related node [[2003 04 22 russell beattie delineating devices]]

⥅ related node [[2003 04 23 coffee with honey and snow]]

⥅ related node [[2003 04 24 finely interwingled blogging]]

⥅ related node [[2003 04 28 new ipods edit and music downloads]]

⥅ related node [[2003 04 29 testing bloggar]]

⥅ related node [[2003 04 30 apple borked me again]]

⥅ related node [[2003 05 03 audioscrobbler]]

⥅ related node [[2003 05 04 now with docking station]]

⥅ related node [[2003 05 06 trevorj annoying password prompts in os x]]

⥅ related node [[2003 05 07 linkedin friendster without the gonad centrism]]

⥅ related node [[2003 05 09 business 2 0 is tivo next]]

⥅ related node [[2003 05 12 powerline networking]]

⥅ related node [[2003 05 13 ever wonder where mime types come from]]

⥅ related node [[2003 05 20 finding andrew jones]]

⥅ related node [[2003 05 20 le grande sucre a k a big sugar]]

⥅ related node [[2003 05 20 north america is toast aka build a wireless network stupid]]

⥅ related node [[2003 05 23 i know where you live]]

⥅ related node [[2003 05 24 camino]]

⥅ related node [[2003 05 24 the inquirer why palm is doomed]]

⥅ related node [[2003 05 25 federated identity management]]

⥅ related node [[2003 05 26 don parks blog introducing chaos to social software]]

⥅ related node [[2003 05 26 on the bursty evolution of blogspace]]

⥅ related node [[2003 05 27 circus ponies notebook and aquaminds notetaker]]

⥅ related node [[2003 05 28 itunes is successful or maybe not]]

⥅ related node [[2003 05 30 social software link fest]]

⥅ related node [[2003 05 30 wifi plus phones]]

⥅ related node [[2003 06 01 saving private links]]

⥅ related node [[2003 06 01 steve jobs no tablet for you]]

⥅ related node [[2003 06 01 what is a person connected to]]

⥅ related node [[2003 06 05 how to get rich]]

⥅ related node [[2003 06 05 xnsorg]]

⥅ related node [[2003 06 07 what time is it anyway]]

⥅ related node [[2003 06 08 welcome to the liquor store]]

⥅ related node [[2003 06 09 joi ito attention concentration and becoming a place]]

⥅ related node [[2003 06 10 my place]]

⥅ related node [[2003 06 12 on trackback and why you should smoke refer instead]]

⥅ related node [[2003 06 20 now with jabber]]

⥅ related node [[2003 06 20 rss weather]]

⥅ related node [[2003 06 20 tim bray rss promise and peril]]

⥅ related node [[2003 06 22 cruelacid php realtime weather]]

⥅ related node [[2003 06 23 apple debuts ppc 970 machines]]

⥅ related node [[2003 06 23 everymac]]

⥅ related node [[2003 06 23 lloyd wants to know]]

⥅ related node [[2003 06 25 working with ichat]]

⥅ related node [[2003 07 02 environment canada faq]]

⥅ related node [[2003 07 03 more fun with rss weather]]

⥅ related node [[2003 07 08 small business directory service ideas maybe a beer]]

⥅ related node [[2003 07 15 rbrowser lite]]

⥅ related node [[2003 07 15 transmit]]

⥅ related node [[2003 07 22 java and handhelds goodbye palm]]

⥅ related node [[2003 07 22 wired news tired of the telly reprogram it]]

⥅ related node [[2003 07 24 my blogroll]]

⥅ related node [[2003 07 25 bittorrent]]

⥅ related node [[2003 07 28 a polluted trust web]]

⥅ related node [[2003 07 28 boing boing patent for mind control via tv blipverts]]

⥅ related node [[2003 07 31 tribe net feedback]]

⥅ related node [[2003 08 01 is blogging breaking googles usefulness]]

⥅ related node [[2003 08 01 rss is mainly client side]]

⥅ related node [[2003 08 04 bankrupt emi]]

⥅ related node [[2003 08 04 finally in canada]]

⥅ related node [[2003 08 04 free world dialup]]

⥅ related node [[2003 08 05 infoworld sun tips apple hat]]

⥅ related node [[2003 08 06 drupal upgrade]]

⥅ related node [[2003 08 07 install completed]]

⥅ related node [[2003 08 08 arrr pirate names]]

⥅ related node [[2003 08 09 congrats on the new blog andrew]]

⥅ related node [[2003 08 09 coppermine]]

⥅ related node [[2003 08 09 gallery]]

⥅ related node [[2003 08 09 stylesheet wrangling]]

⥅ related node [[2003 08 09 wired news 101 uses for apple ichat]]

⥅ related node [[2003 08 10 art gallery and byward market]]

⥅ related node [[2003 08 11 extremetech clash of the tiny titans]]

⥅ related node [[2003 08 11 wired news mr disruption strikes again]]

⥅ related node [[2003 08 12 turning down friends]]

⥅ related node [[2003 08 13 imaginary friends]]

⥅ related node [[2003 08 13 wandering back to victoria]]

⥅ related node [[2003 08 14 drupal]]

⥅ related node [[2003 08 15 ottawa power outage]]

⥅ related node [[2003 08 16 p r o f i l e]]

⥅ related node [[2003 08 16 spaces is clever cactus]]

⥅ related node [[2003 08 17 p r o f i l e]]

⥅ related node [[2003 08 17 steve gillmor another fine mesh]]

⥅ related node [[2003 08 18 ninja school]]

⥅ related node [[2003 08 18 phpwiki]]

⥅ related node [[2003 08 18 pmachine]]

⥅ related node [[2003 08 18 rodin]]

⥅ related node [[2003 08 18 soundfeeder wireless audio adapter]]

⥅ related node [[2003 08 18 tech report the msi mega pc and abit sff]]

⥅ related node [[2003 08 20 apple rumours]]

⥅ related node [[2003 08 21 canadian voip]]

⥅ related node [[2003 08 25 image module installed test yours now]]

⥅ related node [[2003 08 25 phpcommunitycalendar]]

⥅ related node [[2003 08 27 9 mac browser shootout]]

⥅ related node [[2003 08 28 design challenge]]

⥅ related node [[2003 08 28 initial release of iphototogallery]]

⥅ related node [[2003 09 02 daring fireball vaporoffice]]

⥅ related node [[2003 09 02 pvr blog snapstream personal video station 3 0 review]]

⥅ related node [[2003 09 03 openweather]]

⥅ related node [[2003 09 03 underground london world weather rss feeds]]

⥅ related node [[2003 09 04 clearing your favicon cache]]

⥅ related node [[2003 09 06 meta web publishing]]

⥅ related node [[2003 09 24 cinemaclock movie listings ottawa]]

⥅ related node [[2003 09 24 commsdesign voip chip targets home gateways]]

⥅ related node [[2003 09 24 matchstick men]]

⥅ related node [[2003 09 25 extremetech building a wireless home media network server]]

⥅ related node [[2003 09 29 wifi voip phone from jeff pulver]]

⥅ related node [[2003 09 30 windows media center edition 2004 new version]]

⥅ related node [[2003 10 01 notify enabled plus my other sites]]

⥅ related node [[2003 10 04 appleinsider ibook upgrade and panther server]]

⥅ related node [[2003 10 04 rss data]]

⥅ related node [[2003 10 04 subethaedit]]

⥅ related node [[2003 10 05 walk along the canal]]

⥅ related node [[2003 10 06 micro solutions backpack wireless workgroup server]]

⥅ related node [[2003 10 07 asus digimatrix]]

⥅ related node [[2003 10 07 developers notebook]]

⥅ related node [[2003 10 07 scaleable mmorpg]]

⥅ related node [[2003 10 08 how does a game company start]]

⥅ related node [[2003 10 08 windows rss readers]]

⥅ related node [[2003 10 09 mmorpg start small]]

⥅ related node [[2003 10 15 quickies its small form factor craziness]]

⥅ related node [[2003 10 15 salmon of doubt review plus more on douglas adams]]

⥅ related node [[2003 10 21 converting ical calendar files into html]]

⥅ related node [[2003 10 22 computerworld free hot spots pay dividends]]

⥅ related node [[2003 10 22 itunes for windows]]

⥅ related node [[2003 10 24 three column layouts]]

⥅ related node [[2003 10 25 site re design]]

⥅ related node [[2003 10 26 blogs are torpedoes]]

⥅ related node [[2003 10 26 review acomdata multimediaviewer]]

⥅ related node [[2003 10 27 canada post postal code locator]]

⥅ related node [[2003 10 27 cbc has a free headline service but no rss feed]]

⥅ related node [[2003 10 27 dont ask why i need to remember this page]]

⥅ related node [[2003 10 27 its just common sense]]

⥅ related node [[2003 10 27 longhorns special sauce]]

⥅ related node [[2003 10 28 mailbucket org]]

⥅ related node [[2003 10 31 ez ip update]]

⥅ related node [[2003 11 01 gourmet sleuth roasting timetable]]

⥅ related node [[2003 11 02 carbon copy cloner]]

⥅ related node [[2003 11 03 ibm to build chips for xbox 2]]

⥅ related node [[2003 11 03 ole eichhorn comments on xaml and the pdc experience]]

⥅ related node [[2003 11 04 ehomeupgrade pre packaged media servers]]

⥅ related node [[2003 11 06 panther bits]]

⥅ related node [[2003 11 08 extremetech media front end roundup]]

⥅ related node [[2003 11 08 knoppmyth]]

⥅ related node [[2003 11 09 myie2]]

⥅ related node [[2003 11 09 panther in the house]]

⥅ related node [[2003 11 09 vlc media player]]

⥅ related node [[2003 11 11 coreblog]]

⥅ related node [[2003 11 11 itunes album art and cell phones]]

⥅ related node [[2003 11 11 opensourcexperts]]

⥅ related node [[2003 11 11 what kind of social software are you]]

⥅ related node [[2003 11 12 cowiki]]

⥅ related node [[2003 11 12 movabletype]]

⥅ related node [[2003 11 12 serendipity]]

⥅ related node [[2003 11 13 sites offline plus my own multimedia pc]]

⥅ related node [[2003 11 17 feedback points to spoke serences klipfolio]]

⥅ related node [[2003 11 17 groupcal]]

⥅ related node [[2003 11 17 spoke]]

⥅ related node [[2003 11 17 theming drupal]]

⥅ related node [[2003 11 18 sharing itunes and iphoto libraries between users]]

⥅ related node [[2003 11 18 squeezebox]]

⥅ related node [[2003 11 18 video monitoring with e smith]]

⥅ related node [[2003 11 20 boris and bob is there a connection]]

⥅ related node [[2003 11 20 opensourcexperts redux]]

⥅ related node [[2003 11 21 currency converter bank of canada]]

⥅ related node [[2003 11 21 magnolia]]

⥅ related node [[2003 11 22 cmsreview feature directory]]

⥅ related node [[2003 11 22 ical birthday shifter]]

⥅ related node [[2003 11 24 flexible layout]]

⥅ related node [[2003 11 25 reading up on social software]]

⥅ related node [[2003 12 01 unofficial mozilla for mac os 9]]

⥅ related node [[2003 12 01 wamcon]]

⥅ related node [[2003 12 05 two wikis and a microphone]]

⥅ related node [[2003 12 08 itunes catalog]]

⥅ related node [[2003 12 11 classification for email and images]]

⥅ related node [[2003 12 11 css maxdesign com au]]

⥅ related node [[2003 12 11 david isenberg smart letter 91]]

⥅ related node [[2003 12 11 minding the planet the birth of the metaweb]]

⥅ related node [[2003 12 11 sagetv frey technologies]]

⥅ related node [[2003 12 11 snarbs controller salling clicker plug ins]]

⥅ related node [[2003 12 17 fatport now offering voip service through mobitus]]

⥅ related node [[2003 12 17 return of the awesome]]

⥅ related node [[2003 12 17 ventureblog conserving social capital]]

⥅ related node [[2003 12 18 a week with the sony ericsson t616]]

⥅ related node [[2003 12 18 cnet voip top priority for bell canada in 2004]]

⥅ related node [[2003 12 18 more instant messaging from acm queue]]

⥅ related node [[2003 12 19 whohasmybirthday com]]

⥅ related node [[2003 12 23 is the pstn more secure]]

⥅ related node [[2003 12 23 voip channels to market]]

⥅ related node [[2004 01 02 macosx com apple ibox in production]]

⥅ related node [[2004 01 03 sony ericsson handsfree hpr 20]]

⥅ related node [[2004 01 04 a whole lotta nothing social software ideas]]

⥅ related node [[2004 01 04 howardforums t616 beginner info]]

⥅ related node [[2004 01 04 pluto home]]

⥅ related node [[2004 01 04 quicksub]]

⥅ related node [[2004 01 04 running your own social network]]

⥅ related node [[2004 01 04 use of social network sites accelerating]]

⥅ related node [[2004 01 04 vancouver knowledge management community of practice kmcop]]

⥅ related node [[2004 01 09 talkbroadband canadian voip with primus]]

⥅ related node [[2004 01 13 ripdigital]]

⥅ related node [[2004 01 13 trevor jones has a blog]]

⥅ related node [[2004 01 14 the corporation]]

⥅ related node [[2004 01 14 translink to run passenger ferries to bowen]]

⥅ related node [[2004 01 14 tunesatwork]]

⥅ related node [[2004 01 14 vovida org]]

⥅ related node [[2004 01 15 simon willison you mean there is an ie team]]

⥅ related node [[2004 01 16 businessweek technology special report voip]]

⥅ related node [[2004 01 16 favicon generation]]

⥅ related node [[2004 01 16 new favicon]]

⥅ related node [[2004 01 16 shopkits]]

⥅ related node [[2004 01 16 vms3 info social networking industry analyzed via the value framework]]

⥅ related node [[2004 01 18 shrook]]

⥅ related node [[2004 01 18 using php to integrate rss feeds into your website]]

⥅ related node [[2004 01 21 plastic bags make great shoes]]

⥅ related node [[2004 01 22 online identity pollution is happening today]]

⥅ related node [[2004 01 25 talkbroadband first setup]]

⥅ related node [[2004 01 28 getting a place in vancouver]]

⥅ related node [[2004 01 28 talkbroadband some glitches and solutions]]

⥅ related node [[2004 01 29 darren barefoot exciting news indeed]]

⥅ related node [[2004 01 29 om malik tivo the digital hub powered by strangeberry]]

⥅ related node [[2004 01 29 sunshine coast accommodations]]

⥅ related node [[2004 01 30 roland tanglao vancouver geek dinner]]

⥅ related node [[2004 02 01 canadians are square]]

⥅ related node [[2004 02 01 talkbroadband forum setup]]

⥅ related node [[2004 02 02 zerendipity nick tattersall vef meeting]]

⥅ related node [[2004 02 04 globe and mail has rss feeds]]

⥅ related node [[2004 02 04 social networking vs blogging]]

⥅ related node [[2004 02 05 dining out for life]]

⥅ related node [[2004 02 05 globe and mail monster com to add networking]]

⥅ related node [[2004 02 05 intravnews]]

⥅ related node [[2004 02 05 mailpictures]]

⥅ related node [[2004 02 05 westworld computers on broadway in vancouver]]

⥅ related node [[2004 02 06 ichat bluetooth headset phone]]

⥅ related node [[2004 02 06 talkbroadband steady state]]

⥅ related node [[2004 02 06 wordpress]]

⥅ related node [[2004 02 08 bloglet]]

⥅ related node [[2004 02 08 vijs recommended by stuart mclean]]

⥅ related node [[2004 02 09 just signed up for spud]]

⥅ related node [[2004 02 10 media server consumer electronics sony should buy apple]]

⥅ related node [[2004 02 11 more peeps with blogs]]

⥅ related node [[2004 02 11 vancouver geek dinner wrap up]]

⥅ related node [[2004 02 13 does speed advantage mean mac tipping point]]

⥅ related node [[2004 02 13 no tv watching the latest episodes]]

⥅ related node [[2004 02 13 pictures of newfoundland snowstorm]]

⥅ related node [[2004 02 15 cvsfinder]]

⥅ related node [[2004 02 16 flickr kicks off rich media arms race for social networking apps]]

⥅ related node [[2004 02 16 j2ee consulting with eversun software]]

⥅ related node [[2004 02 16 linux news from browser to platform mozilla rises]]

⥅ related node [[2004 02 16 netomat]]

⥅ related node [[2004 02 16 reblogging]]

⥅ related node [[2004 02 16 userplane]]

⥅ related node [[2004 02 16 winter storm damage in vancouver and victoria]]

⥅ related node [[2004 02 18 ichat flickr et al and skype]]

⥅ related node [[2004 02 18 k scott allen newsgroups blogs and magazines]]

⥅ related node [[2004 02 18 karma mailing list]]

⥅ related node [[2004 02 18 phpgedview]]

⥅ related node [[2004 02 18 yahoo new search engine does rss]]

⥅ related node [[2004 02 19 flickr services]]

⥅ related node [[2004 02 19 mkc networks offers voip licenses for e smith]]

⥅ related node [[2004 02 19 side discussions for increasing signal to noise]]

⥅ related node [[2004 02 20 radio doesnt get it]]

⥅ related node [[2004 02 22 10 random songs]]

⥅ related node [[2004 02 22 big time bellevue geek dinner]]

⥅ related node [[2004 02 22 kids and social software]]

⥅ related node [[2004 02 22 well designed weblogs]]

⥅ related node [[2004 02 23 caterina net things to do in vancouver]]

⥅ related node [[2004 02 23 cms mailing list]]

⥅ related node [[2004 02 23 pseudorandom vancouver hilights]]

⥅ related node [[2004 02 23 textpattern]]

⥅ related node [[2004 02 23 validate your code]]

⥅ related node [[2004 02 23 zip ca]]

⥅ related node [[2004 02 24 boris big book list oh boy]]

⥅ related node [[2004 02 24 dot easy]]

⥅ related node [[2004 02 24 geourl updated]]

⥅ related node [[2004 02 24 kate and i are oktoberfest stars]]

⥅ related node [[2004 02 25 meyers briggs]]

⥅ related node [[2004 02 25 robert scoble i still dont get social software]]

⥅ related node [[2004 02 25 the rs have it]]

⥅ related node [[2004 02 26 ms access why the need for visual basic]]

⥅ related node [[2004 02 27 yet more content from me]]

⥅ related node [[2004 02 29 more xbox 2 and windows on g5 info]]

⥅ related node [[2004 03 01 nova spivack the pattern of online technology fads]]

⥅ related node [[2004 03 01 rolands big move]]

⥅ related node [[2004 03 01 the snow walker]]

⥅ related node [[2004 03 03 aaron cope extensions to xml resume]]

⥅ related node [[2004 03 03 hr xml]]

⥅ related node [[2004 03 03 xml com xml power job hunting]]

⥅ related node [[2004 03 03 xml resume and resume promotion]]

⥅ related node [[2004 03 03 xml resume at sourceforge]]

⥅ related node [[2004 03 05 consumer voip arrives in the us]]

⥅ related node [[2004 03 05 sick of social networks]]

⥅ related node [[2004 03 07 digital web magazine in defense of fahrner image replacement]]

⥅ related node [[2004 03 07 image replacement decision grid]]

⥅ related node [[2004 03 07 reading update]]

⥅ related node [[2004 03 07 seo use images wisely]]

⥅ related node [[2004 03 07 sites that dont work reveal ca]]

⥅ related node [[2004 03 07 stop design using background image to replace text]]

⥅ related node [[2004 03 07 test postflickr test post]]

⥅ related node [[2004 03 07 use of the longdesc attribute for img tags]]

⥅ related node [[2004 03 07 w3c markup validation service]]

⥅ related node [[2004 03 07 why rss sucks but its still fantastic]]

⥅ related node [[2004 03 08 rankpulse]]

⥅ related node [[2004 03 09 asi exchange in vancouver]]

⥅ related node [[2004 03 09 flickr buddy icons fun]]

⥅ related node [[2004 03 09 i hate the term blog]]

⥅ related node [[2004 03 10 webworkshop net googles pagerank explained]]

⥅ related node [[2004 03 11 broadvox is coming to canada]]

⥅ related node [[2004 03 11 free email and other options for not using web based email]]

⥅ related node [[2004 03 11 wired news cable guy whupping phone guy]]

⥅ related node [[2004 03 15 vancouver dinner club inaugural event]]

⥅ related node [[2004 03 15 webpronews blogs mean better listings on google]]

⥅ related node [[2004 03 16 what if voice were free]]

⥅ related node [[2004 03 19 how to build a business around voip]]

⥅ related node [[2004 03 19 movabletype is the windows of the personal publishing world]]

⥅ related node [[2004 03 21 nimcat networks]]

⥅ related node [[2004 03 22 deleting installed packages under os x]]

⥅ related node [[2004 03 23 wired pay once share often with lwdrm]]

⥅ related node [[2004 03 25 open source voipworks]]

⥅ related node [[2004 03 25 voodoopad]]

⥅ related node [[2004 03 28 italk2u]]

⥅ related node [[2004 03 28 lunch with microsoft and sun]]

⥅ related node [[2004 03 28 ollicle text 2 html without the lock down]]

⥅ related node [[2004 03 28 om malik on voip why skype is no different]]

⥅ related node [[2004 03 28 presence blogging]]

⥅ related node [[2004 03 28 tips for andy]]

⥅ related node [[2004 03 29 apple should license fairplay drm]]

⥅ related node [[2004 03 29 asterisk dont blame the users]]

⥅ related node [[2004 03 29 does computer science in academia suck]]

⥅ related node [[2004 03 29 lost boy scattered self]]

⥅ related node [[2004 03 29 mac or pc everyone at wordpress wants a powerbook]]

⥅ related node [[2004 03 29 mac os rumors mac os x 10 4 and the year of the g5]]

⥅ related node [[2004 03 29 microsoft now does search]]

⥅ related node [[2004 03 29 price hostilities in the voip space]]

⥅ related node [[2004 03 29 primus talkbroadband expands service]]

⥅ related node [[2004 03 30 consumer price index cpi inflation calculator]]

⥅ related node [[2004 03 30 expose and windows]]

⥅ related node [[2004 03 30 marcosweskamp a map of the news media]]

⥅ related node [[2004 03 30 sipura announces voip pstn gateway adaptor]]

⥅ related node [[2004 03 30 social networking its the apps stupid]]

⥅ related node [[2004 03 30 vonage sues at and t]]

⥅ related node [[2004 03 30 welcome to the new b mann consulting]]

⥅ related node [[2004 03 31 asterisk ideas for client education]]

⥅ related node [[2004 03 31 from manila to drupal]]

⥅ related node [[2004 03 31 minding the planet google launches gmail]]

⥅ related node [[2004 03 31 situational software]]

⥅ related node [[2004 03 31 the register circuit city buys intertan]]

⥅ related node [[2004 03 31 vonage now live in canada]]

⥅ related node [[2004 04 01 im will win voip]]

⥅ related node [[2004 04 04 adding adsense to your rss feed]]

⥅ related node [[2004 04 04 fastmobile another better than skype application]]

⥅ related node [[2004 04 04 mankind vs microsoft]]

⥅ related node [[2004 04 05 asterisk for tech support voicemail]]

⥅ related node [[2004 04 05 document management for small business]]

⥅ related node [[2004 04 05 primus talkbroadband updates pricing features to compete]]

⥅ related node [[2004 04 05 simon willison personalisation weve already got it]]

⥅ related node [[2004 04 06 less blogging more personal publishing]]

⥅ related node [[2004 04 06 near time flow]]

⥅ related node [[2004 04 06 schubert it plugins]]

⥅ related node [[2004 04 06 test your voip]]

⥅ related node [[2004 04 06 voip testing]]

⥅ related node [[2004 04 07 blow to canadian voip]]

⥅ related node [[2004 04 07 pdtp lets get rid of ftp]]

⥅ related node [[2004 04 07 personal publishing is not just tech]]

⥅ related node [[2004 04 07 voip value adds]]

⥅ related node [[2004 04 08 big telcos may do better than you think]]

⥅ related node [[2004 04 08 first mac os x trojan]]

⥅ related node [[2004 04 08 trademarking your key words]]

⥅ related node [[2004 04 11 blogware adds friends and address book]]

⥅ related node [[2004 04 11 darren tries adsense]]

⥅ related node [[2004 04 12 another life log application]]

⥅ related node [[2004 04 12 session border controllers combined with firewalls]]

⥅ related node [[2004 04 12 softswitch projected growth numbers]]

⥅ related node [[2004 04 12 telepocalypse open systems will continue to crush closed ones]]

⥅ related node [[2004 04 12 vocaldata powers voip for primus telus]]

⥅ related node [[2004 04 13 a stew of packetized content]]

⥅ related node [[2004 04 14 a whole lotta nothing all hail bluetooth]]

⥅ related node [[2004 04 14 peer1 spawns symmetric broadband]]

⥅ related node [[2004 04 15 get your own blog or the real problem with typekey]]

⥅ related node [[2004 04 15 good apps on mac os x]]

⥅ related node [[2004 04 15 primus buys magma]]

⥅ related node [[2004 04 17 disrupting the canadian ip communications industry]]

⥅ related node [[2004 04 18 4000us per month for playing a game]]

⥅ related node [[2004 04 18 blogger meeting in seattle on wednesday night]]

⥅ related node [[2004 04 18 pulpfiction new aggregator for os x]]

⥅ related node [[2004 04 20 alec saunders leaves versatel starts iotum]]

⥅ related node [[2004 04 20 at and t voip marketing in ny]]

⥅ related node [[2004 04 20 batelle on furl]]

⥅ related node [[2004 04 20 phonepage homepage]]

⥅ related node [[2004 04 20 show value in k logs to senior management]]

⥅ related node [[2004 04 21 scribbling net help the googlebot understand your web site]]

⥅ related node [[2004 04 23 feedback for doc searls it garage]]

⥅ related node [[2004 04 23 start with smart edges and a dumb center]]

⥅ related node [[2004 04 23 trendiq tracks internet presence of social networking sites]]

⥅ related node [[2004 04 26 hyperlocal]]

⥅ related node [[2004 04 26 microsoft expression for mac]]

⥅ related node [[2004 04 26 scalix does exchange on linux]]

⥅ related node [[2004 04 26 stealth enum registry]]

⥅ related node [[2004 04 26 tasks pro 1 1]]

⥅ related node [[2004 04 26 website css circa 2011]]

⥅ related node [[2004 04 27 at and t callvantage details]]

⥅ related node [[2004 04 27 gush for os x]]

⥅ related node [[2004 04 27 jons radio active r and eacutesum and eacutes]]

⥅ related node [[2004 04 27 medium and large business voip has 50 cagr]]

⥅ related node [[2004 04 27 more on project management tools]]

⥅ related node [[2004 04 27 spike]]

⥅ related node [[2004 04 27 subethatrack]]

⥅ related node [[2004 04 27 thank you moveable type]]

⥅ related node [[2004 04 27 this is visualstreet net]]

⥅ related node [[2004 04 28 and what about contact management and calendaring]]

⥅ related node [[2004 04 29 big fat dumb pipes]]

⥅ related node [[2004 04 29 callvantage service works well]]

⥅ related node [[2004 04 29 why ecademy will succeed]]

⥅ related node [[2004 04 30 deep enterprise search]]

⥅ related node [[2004 04 30 qwest eliminates access charges on true voip calls]]

⥅ related node [[2004 04 30 skype to speak out at von canada 2004]]

⥅ related node [[2004 05 04 free enum efforts]]

⥅ related node [[2004 05 04 next version of wordpress goes beta]]

⥅ related node [[2004 05 05 drupal powers motime and splinder]]

⥅ related node [[2004 05 05 sprint canadas bad web presence]]

⥅ related node [[2004 05 06 jeff pulver blog free world dialup now supports asterisk]]

⥅ related node [[2004 05 06 new bloggers on the block]]

⥅ related node [[2004 05 06 talkbroadband vs telus]]

⥅ related node [[2004 05 08 evans on nyt article voip in canada]]

⥅ related node [[2004 05 08 price service and port blocking wars]]

⥅ related node [[2004 05 08 snapstream firefly remote giveaway]]

⥅ related node [[2004 05 08 social networking doesnt have a business model]]

⥅ related node [[2004 05 08 social software ideas in practice]]

⥅ related node [[2004 05 08 what is a wiki]]

⥅ related node [[2004 05 08 zoe and email choices]]

⥅ related node [[2004 05 09 dell might buy palmone]]

⥅ related node [[2004 05 09 mt vs ee for a corporate weblogs farm]]

⥅ related node [[2004 05 09 newspapers see danger in text messaging]]

⥅ related node [[2004 05 09 that old trackback magic]]

⥅ related node [[2004 05 09 voice goes live in the corporate data center]]

⥅ related node [[2004 05 10 web hosting server control panels]]

⥅ related node [[2004 05 13 iphoto to everything]]

⥅ related node [[2004 05 15 do not buy an inexq wireless router]]

⥅ related node [[2004 05 15 palm gphone does sip]]

⥅ related node [[2004 05 15 wifi box]]

⥅ related node [[2004 05 15 wrt54g firmware]]

⥅ related node [[2004 05 16 a quick way to generate obvious links]]

⥅ related node [[2004 05 16 civicspace labs]]

⥅ related node [[2004 05 16 editthispagephp]]

⥅ related node [[2004 05 16 information overload dissolves into nothingness]]

⥅ related node [[2004 05 16 less typing more linking]]

⥅ related node [[2004 05 16 tables vs css in web standards]]

⥅ related node [[2004 05 16 whats new in mt 3 0 other than a licensing controversy]]

⥅ related node [[2004 05 17 bitpal address book and to dos on your removable drive]]

⥅ related node [[2004 05 17 rendezvous wifi foaf people in my neighbourhood]]

⥅ related node [[2004 05 17 robotradio]]

⥅ related node [[2004 05 18 darwinports]]

⥅ related node [[2004 05 18 entellium]]

⥅ related node [[2004 05 18 fast dsl]]

⥅ related node [[2004 05 18 goodbye calltrex]]

⥅ related node [[2004 05 18 google image ads offer free brand advertising]]

⥅ related node [[2004 05 18 meta data on the mind]]

⥅ related node [[2004 05 18 more mt vs ee]]

⥅ related node [[2004 05 18 most companies never change direction until they hit the wall]]

⥅ related node [[2004 05 18 os x on windows via pearpc]]

⥅ related node [[2004 05 18 palm doing well in smartphone market]]

⥅ related node [[2004 05 18 roku soundbridge]]

⥅ related node [[2004 05 18 search changes how business works]]

⥅ related node [[2004 05 18 subethaedit turns 2 0]]

⥅ related node [[2004 05 18 talking about drupal usability]]

⥅ related node [[2004 05 18 telus microcell an unholy union]]

⥅ related node [[2004 05 19 lagerway vs zennstrom smackdown]]

⥅ related node [[2004 05 24 ted shelton will telephony go to zero dollars]]

⥅ related node [[2004 05 24 why i will likely delete my ecademy account]]

⥅ related node [[2004 05 25 voxilla skype adds pictures]]

⥅ related node [[2004 05 26 flickr news cool stuff i want to pay for]]

⥅ related node [[2004 05 26 peerio offically announces themselves]]

⥅ related node [[2004 05 27 atom linkblog instructions]]

⥅ related node [[2004 05 27 drupal does this moderated commments and moderated posts]]

⥅ related node [[2004 05 27 setting up an itunes server in freebsd]]

⥅ related node [[2004 05 28 steve gillmor on gates rss customer driven lock in]]

⥅ related node [[2004 05 29 atom will create the two way web]]

⥅ related node [[2004 05 29 oh crap marketing]]

⥅ related node [[2004 05 29 pubsub linkrank]]

⥅ related node [[2004 05 31 break your news feed to easily lose readers]]

⥅ related node [[2004 05 31 companies prefer authoritarianism to democracy]]

⥅ related node [[2004 05 31 dave winer impressed me today]]

⥅ related node [[2004 05 31 km work effectiveness improvement]]

⥅ related node [[2004 05 31 tumult hyperedit and a rant on collaboration]]

⥅ related node [[2004 06 01 primus talkbroadband is currently down june 1 2004]]

⥅ related node [[2004 06 06 p900 manager]]

⥅ related node [[2004 06 07 apple airport express]]

⥅ related node [[2004 06 07 blogs arent anything special but they are better than cmss]]

⥅ related node [[2004 06 07 don park give rss 2 0 to w3c]]

⥅ related node [[2004 06 07 drupal xtemplate skins from cyberdash]]

⥅ related node [[2004 06 07 dual wan nat router]]

⥅ related node [[2004 06 07 giving ie team members a nugie for standards]]

⥅ related node [[2004 06 07 open standards skype]]

⥅ related node [[2004 06 07 posting to blogware via ms word]]

⥅ related node [[2004 06 07 purple everywhere]]

⥅ related node [[2004 06 07 rss for downloading torrent files]]

⥅ related node [[2004 06 07 the killer apps in drupal for david nunez]]

⥅ related node [[2004 06 07 todayspapers com]]

⥅ related node [[2004 06 07 w3c is the best place for atom to take root]]

⥅ related node [[2004 06 07 weblogs do help businesses]]

⥅ related node [[2004 06 08 comcast testing integrated cable modem and 38 voip box]]

⥅ related node [[2004 06 11 canadians dont know nuthin about voip willis]]

⥅ related node [[2004 06 14 2004 canadian telecom summit]]

⥅ related node [[2004 06 14 being appled]]

⥅ related node [[2004 06 14 brad gibson has entered the building]]

⥅ related node [[2004 06 14 buttress]]

⥅ related node [[2004 06 14 content separated from delivery media]]

⥅ related node [[2004 06 14 jeffrey veen on feedburner and ping o matic]]

⥅ related node [[2004 06 14 pretty sticky things]]

⥅ related node [[2004 06 14 residential voip in canada not looking so good]]

⥅ related node [[2004 06 14 scoble wants full text rss]]

⥅ related node [[2004 06 14 social networking is a feature]]

⥅ related node [[2004 06 14 the big secret of search optimisation]]

⥅ related node [[2004 06 14 tivo online]]

⥅ related node [[2004 06 14 waml vs xaml]]

⥅ related node [[2004 06 14 who needs books]]

⥅ related node [[2004 06 15 maybe my milk will tell the fridge jokes]]

⥅ related node [[2004 06 16 john gruber i am trying to write the out of this stuff]]

⥅ related node [[2004 06 17 google looking at texturize]]

⥅ related node [[2004 06 17 my ilec charges me to call numbers 10 miles away]]

⥅ related node [[2004 06 18 erik lagerway wants to take the gloves off]]

⥅ related node [[2004 06 18 is drupal a second generation blog rss aggregation site]]

⥅ related node [[2004 06 18 no more ca for non canadians]]

⥅ related node [[2004 06 18 subversion for os x]]

⥅ related node [[2004 06 18 sxip comes out of stealth]]

⥅ related node [[2004 06 18 the bleeding edge of the web has moved away from html]]

⥅ related node [[2004 06 18 x ten interface is terrible]]

⥅ related node [[2004 06 19 social networking inaccuracies]]

⥅ related node [[2004 06 23 another victory for hardware raid]]

⥅ related node [[2004 07 06 bell does 5 for 1000 long distance minutes]]

⥅ related node [[2004 07 06 bloggers are becoming subject matter experts]]

⥅ related node [[2004 07 06 blogging tools suck]]

⥅ related node [[2004 07 06 dont expect a converged information superhighway]]

⥅ related node [[2004 07 06 drm inhibits communications]]

⥅ related node [[2004 07 06 knopsterisk]]

⥅ related node [[2004 07 06 make whatever you offer a vehicle for advertisements]]

⥅ related node [[2004 07 06 more types of information to be syndicated]]

⥅ related node [[2004 07 06 os x tiger server does blogging and im]]

⥅ related node [[2004 07 06 pubsub notification via jabber]]

⥅ related node [[2004 07 06 rss is a big blue icon]]

⥅ related node [[2004 07 07 alec and andy do voip futures]]

⥅ related node [[2004 07 07 xoduszero]]

⥅ related node [[2004 07 08 why doesnt apple want to do xhtml]]

⥅ related node [[2004 07 09 yahoo gets odd to go beyond the browser]]

⥅ related node [[2004 07 10 dashboard apps multiplying]]

⥅ related node [[2004 07 10 more oddpost comments]]

⥅ related node [[2004 07 13 common definition of xml readership]]

⥅ related node [[2004 07 13 seb turns off comment counters saves the day]]

⥅ related node [[2004 07 16 time to demonstrate simpletracks again]]

⥅ related node [[2004 07 17 adiumx interview]]

⥅ related node [[2004 07 18 compete on merit]]

⥅ related node [[2004 07 18 off line web applications]]

⥅ related node [[2004 07 18 ongoing reports more mozilla visits than ie]]

⥅ related node [[2004 07 18 people rarely comment]]

⥅ related node [[2004 07 19 asterisk on os x]]

⥅ related node [[2004 07 19 innovation from existing user behavior]]

⥅ related node [[2004 07 19 new brunswick business blog survey]]

⥅ related node [[2004 07 19 ssh keys and subversion on os x]]

⥅ related node [[2004 07 20 spoke vs linkedin]]

⥅ related node [[2004 07 25 sending free sms from a website]]

⥅ related node [[2004 08 19 absentee web landlord]]

⥅ related node [[2004 08 19 vancouver ecademy blogging for business]]

⥅ related node [[2004 08 20 an overview of the basecamp project management system]]

⥅ related node [[2004 08 20 cocoalicious]]

⥅ related node [[2004 08 21 fried potatoes]]

⥅ related node [[2004 08 24 cheap home networking companies are now selling voip adapters]]

⥅ related node [[2004 08 24 im a bryght guy]]

⥅ related node [[2004 08 24 windows is everyones problem]]

⥅ related node [[2004 08 27 vonage ca trying another canadian voip option]]

⥅ related node [[2004 08 27 windows as opposed to linux mt vs wordpress]]

⥅ related node [[2004 08 30 yasn rankings arent newsworthy]]

⥅ related node [[2004 08 31 skype for os x available]]

⥅ related node [[2004 09 06 asterisk for windows]]

⥅ related node [[2004 09 06 broadband telephone numbers]]

⥅ related node [[2004 09 06 google loves im]]

⥅ related node [[2004 09 06 jluster at the social tools weblog]]

⥅ related node [[2004 09 06 john batelle searchblogs new look ad update]]

⥅ related node [[2004 09 10 everyone loves flowers]]

⥅ related node [[2004 09 12 overview of i neighbors]]

⥅ related node [[2004 09 13 viral needs more than just cool]]

⥅ related node [[2004 09 13 writing elsewhere drupal commentary]]

⥅ related node [[2004 09 14 amazons search engine web app heres a9 again]]

⥅ related node [[2004 09 16 tiger ichat has jabber support]]

⥅ related node [[2004 09 17 open comments and the interesting things that can happen]]

⥅ related node [[2004 09 20 15000 paying subscribers in canadian voip marketplace]]

⥅ related node [[2004 09 22 google local in canada so what]]

⥅ related node [[2004 09 29 eric meyers powerpoint implemented in html]]

⥅ related node [[2004 09 29 sha lin noodle house and kristian at kino]]

⥅ related node [[2004 09 29 steamworks invaded by germans]]

⥅ related node [[2004 10 01 im is texting in north america]]

⥅ related node [[2004 10 01 it appears i never have to throw anything away again]]

⥅ related node [[2004 10 01 remembering pitcairn and easter island]]

⥅ related node [[2004 10 03 late blogacatmas entry]]

⥅ related node [[2004 10 03 voip and social software]]

⥅ related node [[2004 10 05 pr isnt dead]]

⥅ related node [[2004 10 06 calendaring in xhtml]]

⥅ related node [[2004 10 06 evan reviews the airport express]]

⥅ related node [[2004 10 07 200 things]]

⥅ related node [[2004 10 14 google invades windows desktops whats the mac plan]]

⥅ related node [[2004 10 20 to quote myself on voip]]

⥅ related node [[2004 10 23 do we actually want one super app]]

⥅ related node [[2004 10 23 not on the web you wont get hired]]

⥅ related node [[2004 10 27 how to pick beer even the kind that comes in a tower]]

⥅ related node [[2004 10 27 zip ca finds my comment thread]]

⥅ related node [[2004 10 28 ipod photo thoughts]]

⥅ related node [[2004 10 30 greenthing theme and this week]]

⥅ related node [[2004 10 31 what do i expect from my blog]]

⥅ related node [[2004 11 01 near time flow example]]

⥅ related node [[2004 11 04 lycoris takes over e smith]]

⥅ related node [[2004 11 04 ubiquitous browser evolution]]

⥅ related node [[2004 11 04 urls are dead]]

⥅ related node [[2004 11 04 voipail is voicemail for skype]]

⥅ related node [[2004 11 07 bittorrent whack a mole give us legal video downloads]]

⥅ related node [[2004 11 07 save canadas internets]]

⥅ related node [[2004 11 09 wow open beta]]

⥅ related node [[2004 11 10 marqui content management in vancouver and blogging for money]]

⥅ related node [[2004 11 11 bmp presents cdx2]]

⥅ related node [[2004 11 12 msn now does search thinks google is a good result]]

⥅ related node [[2004 11 12 panics story of audion]]

⥅ related node [[2004 11 15 the deep web only courtesy of search portal x]]

⥅ related node [[2004 11 19 wow beta is over some comments]]

⥅ related node [[2004 11 21 axentra multifunction server appliances]]

⥅ related node [[2004 11 23 google is a deaf user that loves reading metadata]]

⥅ related node [[2004 11 25 massive traffic on wow still fun]]

⥅ related node [[2004 11 25 todd maffin great work on covering mozilla]]

⥅ related node [[2004 11 28 fotobuzz like flickr notes]]

⥅ related node [[2004 11 28 no games for the mac and gaming micro content]]

⥅ related node [[2004 12 01 itunes canada finally]]

⥅ related node [[2004 12 01 zaks chinese market butter chicken]]

⥅ related node [[2004 12 10 cbc now has headline only rss feeds]]

⥅ related node [[2004 12 16 apple and motorola are making a phone]]

⥅ related node [[2004 12 16 cbc removes agreement on rss usage my feedback email]]

⥅ related node [[2004 12 17 fortune 500 blogging]]

⥅ related node [[2004 12 17 links of interest december 12 2004]]

⥅ related node [[2004 12 19 vote for troys technology buyers manifesto]]

⥅ related node [[2005 01 10 macs rule rss custom rss apps are next]]

⥅ related node [[2005 01 11 aggregators are tomorrows newspapers]]

⥅ related node [[2005 01 11 how the mac mini fits into my life]]

⥅ related node [[2005 01 12 the future of online aggregators skydasher]]

⥅ related node [[2005 01 13 syndication subscription service]]

⥅ related node [[2005 01 14 lcd tv or lcd monitor]]

⥅ related node [[2005 01 16 sell the imac buy the parents a mac mini]]

⥅ related node [[2005 01 17 unlimitel plus question about yak voip in canada]]

⥅ related node [[2005 01 17 zip ca president rick anderson responds to complaints]]

⥅ related node [[2005 01 18 the first business plan with social networking features linkedin]]

⥅ related node [[2005 01 19 please follow]]

⥅ related node [[2005 01 20 2005 will be the year my inboxes die]]

⥅ related node [[2005 01 24 at the blog business summit]]

⥅ related node [[2005 01 27 mac tablet media macs and itunes movies predictions that is]]

⥅ related node [[2005 01 29 stack the mac mini with an apple pvr]]

⥅ related node [[2005 01 31 photo management chain of pain on windows]]

⥅ related node [[2005 02 03 google registrar concepts]]

⥅ related node [[2005 02 07 daring fireball doesnt hate canada]]

⥅ related node [[2005 02 07 no lnp in canada equals no competition]]

⥅ related node [[2005 02 09 lcd tvs and monitors there is no difference]]

⥅ related node [[2005 02 15 my non appearance on cbc talking about voip]]

⥅ related node [[2005 02 16 the deal eo with teleo]]

⥅ related node [[2005 03 04 new phone nokia 6630]]

⥅ related node [[2005 03 07 not exactly a mac mini]]

⥅ related node [[2005 03 07 the best days of voip are yet to come]]

⥅ related node [[2005 03 08 another business just went massively multiplayer]]

⥅ related node [[2005 03 08 mac even more mini rumours come on we know its a tablet]]

⥅ related node [[2005 03 10 skype to offer real phone numbers soon]]

⥅ related node [[2005 03 17 skypein live list of us area codes available]]

⥅ related node [[2005 03 20 links of interest march 20 2004]]

⥅ related node [[2005 03 29 massive and beercasting]]

⥅ related node [[2005 04 02 blog therapist answer 1 aggregating everything]]

⥅ related node [[2005 04 02 blog therapist answer 2 no more meta blogging]]

⥅ related node [[2005 04 02 new header image]]

⥅ related node [[2005 04 02 vancouver webloggers meetup march 31st next web 2 0 meetups]]

⥅ related node [[2005 04 04 google maps now has keynote satellite imagery]]

⥅ related node [[2005 04 11 civilities and viewpoints]]

⥅ related node [[2005 04 13 mac os x tiger what is the one more thing]]

⥅ related node [[2005 04 18 ext2 filesystem for mac os x]]

⥅ related node [[2005 04 18 helping with the gouranga meme]]

⥅ related node [[2005 04 18 mounting ext2 linux filesystems on mac os x]]

⥅ related node [[2005 04 20 skype killing im networks too]]

⥅ related node [[2005 04 27 hire matt may]]

⥅ related node [[2005 04 27 linkies]]

⥅ related node [[2005 04 29 i got bradcasted]]

⥅ related node [[2005 04 29 wiki resume]]

⥅ related node [[2005 05 01 birth of a baby gurl]]

⥅ related node [[2005 05 01 sunday afternoon link o rama]]

⥅ related node [[2005 05 04 how i hate the b word]]

⥅ related node [[2005 05 04 online ad networks or online content networks]]

⥅ related node [[2005 05 08 tiger ized]]

⥅ related node [[2005 05 09 here come itunes purchased video]]

⥅ related node [[2005 05 11 my first itunes video purchase]]

⥅ related node [[2005 05 15 mac asterisk community and dial skype from your address book]]

⥅ related node [[2005 05 19 tiddlywiki as note system]]

⥅ related node [[2005 05 21 first apple store in canada yorkdale in toronto opened today]]

⥅ related node [[2005 06 11 transcending apple hardware]]

⥅ related node [[2005 06 12 count me in for familydimsum event formats]]

⥅ related node [[2005 06 13 widgets for your series 60 phone nokia goes webcore]]

⥅ related node [[2005 06 14 heya neighblog check out my blogmap]]

⥅ related node [[2005 06 21 heading to gnomedex 5 0 in seattle]]

⥅ related node [[2005 06 21 really del icio us easy shared bookmarks]]

⥅ related node [[2005 06 22 the fever theme song]]

⥅ related node [[2005 06 23 start thinking opml]]

⥅ related node [[2005 06 25 mojave and litefeeds]]

⥅ related node [[2005 06 26 gnomedex 2005 closing rumours]]

⥅ related node [[2005 06 26 ie7 rss display safari]]

⥅ related node [[2005 06 26 my two feeds main and complete]]

⥅ related node [[2005 06 26 the dark web]]

⥅ related node [[2005 06 27 blackberry or treo rogers or telus]]

⥅ related node [[2005 06 27 knowledge gardening]]

⥅ related node [[2005 06 27 xbox 360 how microsoft wins]]

⥅ related node [[2005 06 28 itunes 4 9 has podcasting rss and a phone]]

⥅ related node [[2005 06 28 my first video blog the eric rice fanboy edition]]

⥅ related node [[2005 06 29 picking opml no use swimming upstream]]

⥅ related node [[2005 07 03 can you say maps for everyone]]

⥅ related node [[2005 07 03 delicious construction kit]]

⥅ related node [[2005 07 03 gizmo sip client hopes to break skype silo]]

⥅ related node [[2005 07 03 matt may standards evangelist at large]]

⥅ related node [[2005 07 03 scalable distributed backups with bittorrent]]

⥅ related node [[2005 07 03 tag clouds are not a replacement for ui]]

⥅ related node [[2005 07 03 the b word blogrolls are bare links]]

⥅ related node [[2005 07 07 rss opml and pirate weather]]

⥅ related node [[2005 07 08 citizen journalism and the london bombings interview alert]]

⥅ related node [[2005 07 10 richard explains the for tag in del icio us expands on social software]]

⥅ related node [[2005 07 13 isync update means my nokia 6630 now syncs]]

⥅ related node [[2005 07 13 scottstuff is flickring]]

⥅ related node [[2005 07 15 cringely thinks clickstar is itunes movie store]]

⥅ related node [[2005 07 16 pluto home plus squeezebox sonos killer]]

⥅ related node [[2005 07 24 idea farming]]

⥅ related node [[2005 07 25 battle of the widget platforms]]

⥅ related node [[2005 07 25 hanging with the gnomes in seattle dinner anyone]]

⥅ related node [[2005 07 25 telus blocking access to union website]]

⥅ related node [[2005 07 26 dinner in seattle was great]]

⥅ related node [[2005 07 28 vancouver perl mongers with casey west july 28th]]

⥅ related node [[2005 07 29 read only calendars were nice in 2002]]

⥅ related node [[2005 07 30 q why do bloggers sleep]]

⥅ related node [[2005 07 31 gprs nokia 6630 bluetooth powerbook ethernet ibook]]

⥅ related node [[2005 07 31 testing the opml editor]]

⥅ related node [[2005 08 06 rice photo by b mann]]

⥅ related node [[2005 08 08 buying wireless smart stuff choose unlocked and open]]

⥅ related node [[2005 08 08 request for tutorial using sshkeychain]]

⥅ related node [[2005 08 09 ubiquitous mac apps i dont use quicksilver]]

⥅ related node [[2005 08 14 flock feedback]]

⥅ related node [[2005 08 14 you know youre busy when]]

⥅ related node [[2005 08 15 come get your pker and v14gr4 spam is being nuked]]

⥅ related node [[2005 08 19 test post from flock blog manager]]

⥅ related node [[2005 08 23 going to san fran attending burning geek]]

⥅ related node [[2005 08 23 google talks jabber]]

⥅ related node [[2005 08 25 fussing about formats micro or otherwise]]

⥅ related node [[2005 08 28 fido yanking unlimited data plans]]

⥅ related node [[2005 08 28 gmail supports from]]

⥅ related node [[2005 08 29 microformats love vcards]]

⥅ related node [[2005 09 02 link farming the future]]

⥅ related node [[2005 09 02 tagspaces blessed tags and more]]

⥅ related node [[2005 09 06 a microformat for music]]

⥅ related node [[2005 09 06 three ways of syndicating beyond blogging content]]

⥅ related node [[2005 09 07 itunes phone in canada will we be able to rokr]]

⥅ related node [[2005 09 14 google blogsearch launches]]

⥅ related node [[2005 09 15 b mann in wired news]]

⥅ related node [[2005 09 15 my first mobile purchase]]

⥅ related node [[2005 09 15 yiibu crew back to yvr]]

⥅ related node [[2005 09 16 northern voice and moose camp now in blue]]

⥅ related node [[2005 09 16 the new feedback will not be controlled]]

⥅ related node [[2005 09 18 talk like a pirate day]]

⥅ related node [[2005 09 22 barcamp amsterdam or oops we did it again]]

⥅ related node [[2005 09 25 blog flux mapstats]]

⥅ related node [[2005 09 27 uc berkeley photon iphoto plug in test]]

⥅ related node [[2005 09 29 recommended links]]

⥅ related node [[2005 09 29 why web2 0 matters preparing for glocalization]]

⥅ related node [[2005 09 30 the innovation commons]]

⥅ related node [[2005 09 30 welcome to vancouver dan let the outliner games begin]]

⥅ related node [[2005 10 01 invalid btree node size and other joys]]

⥅ related node [[2005 10 02 43 people feedback let me cheer everything]]

⥅ related node [[2005 10 02 news from the uvic alumni association]]

⥅ related node [[2005 10 04 innovation commons first meeting wednesday october 5 2005]]

⥅ related node [[2005 10 04 maps travel and making the world a smaller place]]

⥅ related node [[2005 10 04 why the nokia n91 is delayed voice over wlan support]]

⥅ related node [[2005 10 05 video ipod or airport express video]]

⥅ related node [[2005 10 09 apple predictions how video is useful]]

⥅ related node [[2005 10 14 innovation commons follow up snowball edition]]

⥅ related node [[2005 10 20 drupalcon eurooscon and barcamp amsterdam is hopping]]

⥅ related node [[2005 10 23 back from 3 conferences in amsterdam busy week ahead]]

⥅ related node [[2005 10 24 distributed social networking]]

⥅ related node [[2005 10 26 innovation commons wednesday october 26th 2005 630pm]]

⥅ related node [[2005 10 26 tivo in canada and other pvr info]]

⥅ related node [[2005 11 01 breaking the web wide open]]

⥅ related node [[2005 11 05 audioblog com mini review audio via phone and video posting]]

⥅ related node [[2005 11 05 revver com and other video storage options]]

⥅ related node [[2005 11 07 marc liyanages php apache module]]

⥅ related node [[2005 11 07 mysql 4 1 os x installer]]

⥅ related node [[2005 11 08 ietf 64 social tuesday nov 8th anyone attending]]

⥅ related node [[2005 11 08 speak at northern voice 2006]]

⥅ related node [[2005 11 08 vlc media player]]

⥅ related node [[2005 11 10 opportunities people and tools]]

⥅ related node [[2005 11 11 parceltongue]]

⥅ related node [[2005 11 14 doubletake best panorama stitch tool for mac os x]]

⥅ related node [[2005 11 14 subethaedit]]

⥅ related node [[2005 11 15 innovation commons please take the survey]]

⥅ related node [[2005 11 15 wayfaring]]

⥅ related node [[2005 11 17 yiibu re inventing microcontent]]

⥅ related node [[2005 11 18 shozu]]

⥅ related node [[2005 11 23 syncing itunes music folders using rsync]]

⥅ related node [[2005 11 27 broadband providers blocking podcasts in canada]]

⥅ related node [[2005 11 27 synching itunes with rsync]]

⥅ related node [[2005 11 27 using rsync to sync itunes on two computers]]

⥅ related node [[2005 11 28 icann brings cool people to town geek dinner tuesday]]

⥅ related node [[2005 12 05 lots of domains because its cheap and easy]]

⥅ related node [[2005 12 06 open formats how to make enhanced podcasts without apple]]

⥅ related node [[2005 12 11 wireless data in canada is ridiculously expensive]]

⥅ related node [[2005 12 12 del icio us bought ma gnolia being built]]

⥅ related node [[2005 12 29 2006 will be the year of xmpp]]

⥅ related node [[2006 01 03 allpeers puts bittorrent in the browser]]

⥅ related node [[2006 01 06 liberty alliance people service webcast on january]]

⥅ related node [[2006 01 12 oscms summit is go for launch]]

⥅ related node [[2006 01 25 sameplace]]

⥅ related node [[2006 02 04 free software fosdem attendance]]

⥅ related node [[2006 02 06 cocomment comments]]

⥅ related node [[2006 02 13 identity 2 0 we must federate and cooperate]]

⥅ related node [[2006 02 18 skype benefits and drawbacks]]

⥅ related node [[2006 02 19 how canadian mobile providers are stifling their own growth]]

⥅ related node [[2006 02 27 meeting clipperz]]

⥅ related node [[2006 02 27 standards pingbacking]]

⥅ related node [[2006 02 28 fosdem attendees and european hacker culture]]

⥅ related node [[2006 02 28 jabber at fosdem 2006]]

⥅ related node [[2006 03 04 youtube to itunes]]

⥅ related node [[2006 03 08 barcamp brussels for the impatient]]

⥅ related node [[2006 03 16 dugs drupal user groups that is]]

⥅ related node [[2006 03 23 web 2 0 mesh conference in toronto announced may 15th 16th]]

⥅ related node [[2006 03 28 vancouver is a fine place to start a company or to join one]]

⥅ related node [[2006 03 28 voicemail coming to google talk gmail]]

⥅ related node [[2006 03 29 internet identity workshop open for registration]]

⥅ related node [[2006 04 05 real estate and the web in canada listen to ben]]

⥅ related node [[2006 04 05 windows on a mac apple releases boot camp beta]]

⥅ related node [[2006 04 19 registered for iiw 2006]]

⥅ related node [[2006 04 20 stop with the guest posting already]]

⥅ related node [[2006 04 24 identity profiles and reputation federated networks]]

⥅ related node [[2006 05 02 out of towner dinner in san francisco at osha thai]]

⥅ related node [[2006 05 11 drupalcamp barcamp and mesh conference toronto]]

⥅ related node [[2006 05 14 innovation commons must get built in vancouver]]

⥅ related node [[2006 05 18 verisign chooses openid]]

⥅ related node [[2006 05 19 cloning technology aka technology barriers]]

⥅ related node [[2006 05 19 never miss google blog search]]

⥅ related node [[2006 06 11 socialtext is going open source the return of jluster]]

⥅ related node [[2006 06 14 iosvan identity open space in vancouver in july]]

⥅ related node [[2006 06 24 matchstick ca is buzz marketing gone wrong]]

⥅ related node [[2006 06 25 reverse microformat ing at barcamp san francisco]]

⥅ related node [[2006 06 30 ambient vector doing startup blog in the globe and mail]]

⥅ related node [[2006 06 30 drupal camp seattle finishes gnomedex starts techmeme hacked]]

⥅ related node [[2006 06 30 notify i might have accidentally spammed you]]

⥅ related node [[2006 06 30 stephanie rieger talks mobile snacks]]

⥅ related node [[2006 07 01 gnomedex video let us buy smartphones with bre pettis]]

⥅ related node [[2006 07 01 pop is a machine ethan kaplan at gnomedex]]

⥅ related node [[2006 07 16 bmc blog design]]

⥅ related node [[2006 07 18 jabber geeking merge jep 0080 and jep 0112]]

⥅ related node [[2006 07 23 googles challenge searching the live web]]

⥅ related node [[2006 07 24 out with eba in with nitobi]]

⥅ related node [[2006 07 25 matt everard entrepreunerial pm]]

⥅ related node [[2006 07 26 openid bounties and identity convergence]]

⥅ related node [[2006 07 28 barcamp vancouver and more great vancouver people]]

⥅ related node [[2006 08 07 a vancouver job connection area here on bmc]]

⥅ related node [[2006 08 07 apple notes after wwdc 2006 keynote]]

⥅ related node [[2006 08 08 2paths java web app experts in vancouver]]

⥅ related node [[2006 08 16 officially a member of the jabber software foundation]]

⥅ related node [[2006 08 17 announcing pretzel a python based jabber server on twisted]]

⥅ related node [[2006 08 26 notes from barcamp vancouver]]

⥅ related node [[2006 09 26 back from belgium]]

⥅ related node [[2006 09 26 feed reading via people face to face with ton zijlstra part 1]]

⥅ related node [[2006 09 27 idea fragments face to face with ton zijlstra part 2]]

⥅ related node [[2006 10 11 save us from flash video]]

⥅ related node [[2006 10 13 innovation in vancouver funded by the bdc]]

⥅ related node [[2006 10 19 going to portland drupal identity and geek dinners]]

⥅ related node [[2006 10 20 get your moose on this is your mothers conference]]

⥅ related node [[2006 10 22 mobile apps vs the mobile web]]

⥅ related node [[2006 10 22 nokia e61 first impressions]]

⥅ related node [[2006 11 06 flickr patents interestingness]]

⥅ related node [[2006 11 06 industrial brand creative blogging up a storm]]

⥅ related node [[2006 11 06 switching to google reader]]

⥅ related node [[2006 11 13 google reader update]]

⥅ related node [[2006 11 20 flat rate mobile from 3 in the uk]]

⥅ related node [[2006 11 23 should i learn eclipse xcode or something else]]

⥅ related node [[2006 11 29 innovators gathering tonight at steamworks]]

⥅ related node [[2006 11 29 subscribing to people and gigaom re visited]]

⥅ related node [[2006 11 30 yahoo canada panama search preview at opus hotel]]

⥅ related node [[2006 12 01 northern voice 2007 final speaker submissions]]

⥅ related node [[2006 12 06 social media club vancouver]]

⥅ related node [[2006 12 11 community wireless in vancouver fon meraki something else]]

⥅ related node [[2006 12 17 mybloglog is distributed social networking]]

⥅ related node [[2006 12 17 synching and backing up your itunes music using mp3tunes]]

⥅ related node [[2006 12 18 5 things about me you might not know]]

⥅ related node [[2007 01 02 personal info cloud]]

⥅ related node [[2007 01 08 linkedin answers getting hot]]

⥅ related node [[2007 01 08 openid mashpit in vancouver]]

⥅ related node [[2007 01 09 iphone is a tablet]]

⥅ related node [[2007 01 10 is the iphone really locked to cingular]]

⥅ related node [[2007 01 10 linkedin answers answers]]

⥅ related node [[2007 01 12 northern voice travel bursaries]]

⥅ related node [[2007 01 18 openid mashpit vancouver wrap up]]

⥅ related node [[2007 01 23 buy the monkeyblaster 9000 podcast with elastic path]]

⥅ related node [[2007 01 25 susan mernit on the role of no in product development]]

⥅ related node [[2007 02 07 email is the place where information goes to die]]

⥅ related node [[2007 02 07 marc canter is building his heart out]]

⥅ related node [[2007 02 07 open source in vancouver panel]]

⥅ related node [[2007 02 13 oscms summit at yahoo rolling call for participation]]

⥅ related node [[2007 02 16 guy gavriel kay talk at the viwf]]

⥅ related node [[2007 02 18 wii report]]

⥅ related node [[2007 02 20 subscribe to the social designers at common craft]]

⥅ related node [[2007 02 22 google apps and sxip access identity and the google platform]]

⥅ related node [[2007 03 15 canadian cell phone rates are higher than mexico]]

⥅ related node [[2007 03 20 oscms summit starts thursday]]

⥅ related node [[2007 03 31 install profile api for drupal]]

⥅ related node [[2007 04 09 the travesty of canadian mobile data rates]]

⥅ related node [[2007 04 10 can the crtc help]]

⥅ related node [[2007 04 24 ben wong pushes sutton com out of the nest]]

⥅ related node [[2007 05 02 experimenting with freebase]]

⥅ related node [[2007 05 08 superhappydevhouse vancouver may 11th 2007]]

⥅ related node [[2007 05 12 super happy indeed]]

⥅ related node [[2007 05 14 twitter is jabber]]

⥅ related node [[2007 05 15 gold stars for drupal contrib modules and how to get one]]

⥅ related node [[2007 05 15 twitter is jabber part ii]]

⥅ related node [[2007 05 16 les orchard xmpp for self hosted twitter esque nodes]]

⥅ related node [[2007 05 25 facebook is mall of america]]

⥅ related node [[2007 06 07 12 macbook pro with touchscreen keyboard]]

⥅ related node [[2007 06 10 trip to galiano]]

⥅ related node [[2007 06 11 drupal 5 upgrade]]

⥅ related node [[2007 06 14 freegeek vancouver and vancouver php offer summer of php]]

⥅ related node [[2007 06 16 on facebook apps and friend requests]]

⥅ related node [[2007 06 23 buying an lcd monitor as a tv]]

⥅ related node [[2007 06 23 democampvancouver now with more gong]]

⥅ related node [[2007 06 23 game downloads and experimenting with online games]]

⥅ related node [[2007 06 26 mossberg iphone review no sim card cdma only]]

⥅ related node [[2007 06 30 boris likes to]]

⥅ related node [[2007 06 30 iphone hints]]

⥅ related node [[2007 07 03 testing purple]]

⥅ related node [[2007 07 06 andy smith at the stud in san francisco schmap]]

⥅ related node [[2007 07 06 boring site note which feed do you want]]

⥅ related node [[2007 07 06 feeds and subscriptions]]

⥅ related node [[2007 07 06 more purple]]

⥅ related node [[2007 07 08 boris goes to washington]]

⥅ related node [[2007 07 15 watching the it crowd]]

⥅ related node [[2007 07 16 vancity bikeshare handoff from roland]]

⥅ related node [[2007 07 18 ipipi]]

⥅ related node [[2007 07 18 media deck]]

⥅ related node [[2007 07 18 pswincom]]

⥅ related node [[2007 07 18 sandbox for purple module]]

⥅ related node [[2007 07 18 sweet crazy boy]]

⥅ related node [[2007 07 19 europe photobloggers looking for photography related sponsors]]

⥅ related node [[2007 07 19 looking for drupal saml sp implementation]]

⥅ related node [[2007 07 20 drupalish meetup at smiths pub in victoria was good fun]]

⥅ related node [[2007 07 20 yahoo pipes on upcoming reconfigurable feeds]]

⥅ related node [[2007 07 29 back from boston]]

⥅ related node [[2007 08 01 first joyent taco tuesday meetup at chill winston]]

⥅ related node [[2007 08 02 mac alarm clock this mornings tune]]

⥅ related node [[2007 08 03 openid attribute exchange is portable social networking and more]]

⥅ related node [[2007 08 07 itunes sleep timer itunesshut]]

⥅ related node [[2007 08 12 back]]

⥅ related node [[2007 08 13 new google map stuff link roundup]]

⥅ related node [[2007 08 13 want to buy a gps logging device]]

⥅ related node [[2007 08 14 going swimming]]

⥅ related node [[2007 08 15 pubsub will be something simpler]]

⥅ related node [[2007 08 17 barcamp vancouver 2007 kicks off this eve]]

⥅ related node [[2007 08 18 barcamp vancouver 2007 a wrap]]

⥅ related node [[2007 08 18 going disc golf and to north van]]

⥅ related node [[2007 08 18 notes from geo talk at barcamp vancouver 2007]]

⥅ related node [[2007 08 22 third tuesday attended yesterday npost is today]]

⥅ related node [[2007 08 29 weewar]]

⥅ related node [[2007 08 31 bulk buy of globalsat dg100 gps through expansys]]

⥅ related node [[2007 08 31 can drupal help commoditize facebook app development]]

⥅ related node [[2007 08 31 vanguardistas in barcelona]]

⥅ related node [[2007 09 02 email vs facebook]]

⥅ related node [[2007 09 02 text one free]]

⥅ related node [[2007 09 04 apple rumours sept 2007 touchscreen ipod appletv revs]]

⥅ related node [[2007 09 06 democampvancouver03 september 13th or october 4th]]

⥅ related node [[2007 09 06 uncle fatihs pizza to pigeons park]]

⥅ related node [[2007 09 07 facebook shutting down useful developers]]

⥅ related node [[2007 09 09 ringtones need separate licenses]]

⥅ related node [[2007 09 11 vancouver seo birthday gift alex brabant is emarketing 101]]

⥅ related node [[2007 09 12 vancouver wireless cadre kick off meeting]]

⥅ related node [[2007 09 13 canon s5 is the canon powershot s series is still my favorite]]

⥅ related node [[2007 09 14 vancouver freethenet ca how to buy your wireless mesh node]]

⥅ related node [[2007 09 15 i am heading to barcelona for drupalcon]]

⥅ related node [[2007 09 18 barcelona tapas are delicious]]

⥅ related node [[2007 09 19 phreaky phonez]]

⥅ related node [[2007 09 23 drupalcon barcelona over first drupal association report]]

⥅ related node [[2007 09 24 great memories from barcelona september 2007]]

⥅ related node [[2007 09 28 successful launch party]]

⥅ related node [[2007 09 30 rogers and fido sms message center number]]

⥅ related node [[2007 10 02 media appearance the christy clark show talking freethenet ca]]

⥅ related node [[2007 10 14 colours of fall in vancouver]]

⥅ related node [[2007 10 15 alex is coming to town and needs a cool apartment]]

⥅ related node [[2007 10 15 more digital ethnography information r evolution video]]

⥅ related node [[2007 10 18 congrats to john and igor at handimobility livevote launched]]

⥅ related node [[2007 10 21 class afloat itinerary on google maps]]

⥅ related node [[2007 10 21 the future of facebook q and a]]

⥅ related node [[2007 10 22 drupal in python]]

⥅ related node [[2007 10 31 game console dilemma xbox 360 or sony playstation 3]]

⥅ related node [[2007 10 31 google announces opensocial open api for connecting social networks]]

⥅ related node [[2007 11 02 movember has begun and im behind]]

⥅ related node [[2007 11 05 will wrights ted talk toys that make worlds]]

⥅ related node [[2007 11 05 xbox 360 ftw]]

⥅ related node [[2007 11 13 democampvancouver04 on nov 22nd now with more beer]]

⥅ related node [[2007 11 14 northern voice 2008 is up and rolling in classy brown]]

⥅ related node [[2007 11 17 alqasim electronics]]

⥅ related node [[2007 11 17 blogroll]]

⥅ related node [[2007 11 21 bryght and raincity are joining forces]]

⥅ related node [[2007 11 28 bell launches distances based billing in miles]]

⥅ related node [[2007 11 30 dries announces drupal startup acquia]]

⥅ related node [[2007 11 30 tool time highrise and merlin]]

⥅ related node [[2007 12 03 my adhack for the canon s5 is]]

⥅ related node [[2007 12 10 the multi week summary of missed blog posts]]

⥅ related node [[2007 12 14 i have a mission]]

⥅ related node [[2007 12 18 new jacket]]

⥅ related node [[2007 12 19 not so much with the facebook but strong on mobile]]

⥅ related node [[2007 12 28 help me find out what vegetables and fruit are in season when]]

⥅ related node [[2008 01 07 remember the dg 100 it works on the mac now]]

⥅ related node [[2008 01 16 drupal association general assembly 2008]]

⥅ related node [[2008 01 16 i think i might become an rdf fan boy again]]

⥅ related node [[2008 01 21 rogers gets saner data plans]]

⥅ related node [[2008 01 22 2008 events are go for launch]]

⥅ related node [[2008 01 22 a person who is above all things enamoured by the future]]

⥅ related node [[2008 01 27 iphone nano]]

⥅ related node [[2008 01 31 web directions north 2008 3 stages of dynamic systems wrap up]]

⥅ related node [[2008 02 03 more iphone nokia etc thoughts]]

⥅ related node [[2008 02 03 sucking in delicious]]

⥅ related node [[2008 02 10 federated social networks at barcamp amsterdam iii]]

⥅ related node [[2008 02 14 in san francisco going to drupal 6 release party at parisoma]]

⥅ related node [[2008 02 24 northern voice 2008 wrap]]

⥅ related node [[2008 02 25 flock 1 1 beta tire kicking]]

⥅ related node [[2008 02 27 i utterz]]

⥅ related node [[2008 02 28 utterz rob lewis on strutta super sekret alpha launch]]

⥅ related node [[2008 03 01 post leap day link omnibus]]

⥅ related node [[2008 03 01 utterz leaving yvr for drupalcon boston]]

⥅ related node [[2008 03 01 utterz toronto passing us customs]]

⥅ related node [[2008 03 08 dont follow a brief wrap up]]

⥅ related node [[2008 03 11 utterz morning green phlegm]]

⥅ related node [[2008 03 12 highlights elsewhere attending cci2008 bnn appearance]]

⥅ related node [[2008 03 12 utterz vietnamese on broadway with opa]]

⥅ related node [[2008 03 13 open source stands together]]

⥅ related node [[2008 03 14 cci2008 wrap going offline]]

⥅ related node [[2008 03 24 easter on bowen]]

⥅ related node [[2008 03 24 upcoming events in vancouver april 2008 edition]]

⥅ related node [[2008 04 02 this whole community platform thing might have some legs]]

⥅ related node [[2008 04 06 social graph applications why not for every community website]]

⥅ related node [[2008 04 15 strutta has launched]]

⥅ related node [[2008 04 16 sun labs open house 2008 first post acquisition mysql release]]

⥅ related node [[2008 04 19 snow in vancouver]]

⥅ related node [[2008 04 20 getting chdk working on the canon s5 is from mac os x]]

⥅ related node [[2008 04 22 loadmytracks now supports the globalsat dg 100 on mac os x]]

⥅ related node [[2008 04 24 microsoft social networking patent application on peer to patent]]

⥅ related node [[2008 04 29 rogers is bringing the iphone to canada ctv newsnet edition]]

⥅ related node [[2008 04 30 more vancouver events thoughts on one calendar for techcouver]]

⥅ related node [[2008 05 05 drupalcamp vancouver 2008 this week]]

⥅ related node [[2008 05 15 http zizaksy com]]

⥅ related node [[2008 05 26 testing ad bard a foss friendly ad network]]

⥅ related node [[2008 05 29 from bmann to boris an evolution of usernames]]

⥅ related node [[2008 06 18 drupy aka drupal in python]]

⥅ related node [[2008 06 27 omnibus bbq jungle disk wordpress etc]]

⥅ related node [[2008 07 07 hypemachine nokia podcasting client constant new music]]

⥅ related node [[2008 07 09 rogers to launch iphone in canada with 30 6gb data plan]]

⥅ related node [[2008 07 09 sponsor rachael for the camp moomba yogathon]]

⥅ related node [[2008 07 14 updated mass virtual hosting how to for mac os x leopard]]

⥅ related node [[2008 07 19 site specific browsers for mobile]]

⥅ related node [[2008 07 23 quoted in 24 hours buzz bishops head in the clouds article]]

⥅ related node [[2008 07 30 ibibo]]

⥅ related node [[2008 08 08 new ventures bc mentor panel makes my brain full]]

⥅ related node [[2008 08 16 at vinocamp 2008 for the day]]

⥅ related node [[2008 08 20 sendible]]

⥅ related node [[2008 08 21 global tv blackberry bold launches on rogers]]

⥅ related node [[2008 08 30 nokia n78 first take and setup]]

⥅ related node [[2008 08 31 skype turns 5]]

⥅ related node [[2008 09 04 iyouwe com]]

⥅ related node [[2008 09 26 nowpublic mostpublic index for vancouver]]

⥅ related node [[2008 09 27 sugar on drupal]]

⥅ related node [[2008 10 05 spanning sync for mac to google syncing]]

⥅ related node [[2008 10 23 interesting vancouver 2008 ticket giveaway]]

⥅ related node [[2008 10 26 look ma i made it on hiyaa blog]]

⥅ related node [[2008 11 02 vancouver akoha decksgiving]]

⥅ related node [[2008 11 25 dropbox vs jungledisk]]

⥅ related node [[2008 12 15 google friend connect paves over your site and plonks down a social network]]

⥅ related node [[2008 12 15 redanyway a distributed social network]]

⥅ related node [[2008 12 15 redanyway]]

⥅ related node [[2008 12 15 site upgrade acquia drupal 6]]

⥅ related node [[2009 01 03 quick audio preview of upcoming mobile related posts]]

⥅ related node [[2009 01 05 adhack theming port on odesk]]

⥅ related node [[2009 01 05 apple macworld 2009 rumours macbook ds and still no tablet]]

⥅ related node [[2009 01 08 the 3 stages of ecommerce tools]]

⥅ related node [[2009 01 15 jaiku is going open source on google app engine]]

⥅ related node [[2009 01 18 side loading pre fetching and cloud storage]]

⥅ related node [[2009 02 20 northern voice 2009]]

⥅ related node [[2009 03 08 dc drupalcon 2009]]

⥅ related node [[2009 03 11 om thinks the mac tablet is imminent]]

⥅ related node [[2009 04 04 web apps should let me bring my own storage]]

⥅ related node [[2009 04 15 semantic web community barn raising in vancouver]]

⥅ related node [[2009 04 15 site moved to rimu hosting]]

⥅ related node [[2009 04 19 microplaza shows you links from people you follow on twitter]]

⥅ related node [[2009 04 19 trying out nokia sports tracker]]

⥅ related node [[2009 04 19 tweetlens is the google reader of twitter clients]]

⥅ related node [[2009 04 27 open web vancouver open restaurants open data]]

⥅ related node [[2009 06 03 questions for backbone magazine fixing a stale web site]]

⥅ related node [[2009 06 12 drupal out of the box lets make a community]]

⥅ related node [[2009 06 17 social media is]]

⥅ related node [[2009 07 11 from the drupal archives]]

⥅ related node [[2009 07 28 nameless homeless]]

⥅ related node [[2009 08 22 federated micro blogging for canadian startup networking]]

⥅ related node [[2009 08 22 gnomedex 2009 on first timers]]

⥅ related node [[2009 08 27 barcamp and every conference is what you make of it]]

⥅ related node [[2009 10 05 barcamp vancouver 2009 wrapped]]

⥅ related node [[2009 11 02 speaking acct canada 2009 conference]]

⥅ related node [[2010 01 01 jolicloud http jolicloud com]]

⥅ related node [[2010 01 06 global mobile content music movies gaming all]]

⥅ related node [[2010 01 10 associates]]

⥅ related node [[2010 01 10 travis smith hop studios]]

⥅ related node [[2010 02 14 we failed at making the vancouver 2010 olympi]]

⥅ related node [[2010 03 02 jobs]]

⥅ related node [[2010 03 08 on demand book printing bits come to the real world]]

⥅ related node [[2010 03 13 cloud camp vancouver]]

⥅ related node [[2010 03 25 bc apps for climate action announcement]]

⥅ related node [[2010 03 30 speaking]]

⥅ related node [[2010 04 15 keep calm and carry on]]

⥅ related node [[2010 04 24 speaking social media for social change social media primer]]

⥅ related node [[2010 05 03 roller coaster]]

⥅ related node [[2010 05 05 rachael ashe artist]]

⥅ related node [[2010 05 12 tungle and batchbook now integrated]]

⥅ related node [[2010 06 06 first feature silent auction]]

⥅ related node [[2010 06 06 pei trip unconference]]

⥅ related node [[2010 06 08 batchbook user group and intro june 15th 2010]]

⥅ related node [[2010 06 17 evolving drupal ux by building products]]

⥅ related node [[2010 07 02 distributed commenting disqus echo and intensedebate]]

⥅ related node [[2010 07 02 drupalcon copenhagen 2010]]

⥅ related node [[2010 07 02 grow conference 2010]]

⥅ related node [[2010 07 02 pacific northwest drupal summit 2010]]

⥅ related node [[2010 07 13 how to setup gravity to post to your flickr account]]

⥅ related node [[2010 07 14 the facebook economy]]

⥅ related node [[2010 07 15 bandcamp has a business model]]

⥅ related node [[2010 07 17 contributing to drupal radar]]

⥅ related node [[2010 07 20 arrived in pei visited casa mia cafe]]

⥅ related node [[2010 07 20 tv watching vs time to create wikipedia]]

⥅ related node [[2010 07 21 pei visitors from silicon valley]]

⥅ related node [[2010 08 01 elephants like community roi too]]

⥅ related node [[2010 08 01 were not teaching programming and we should be]]

⥅ related node [[2010 08 05 android developers in vancouver]]

⥅ related node [[2010 08 05 wordpress is a yacht drupal is an aircraft carrier]]

⥅ related node [[2010 08 12 postrank has some really great engagement analytics]]

⥅ related node [[2010 08 18 joining iqmetrix]]

⥅ related node [[2010 08 26 automatic wordpress backup using amazon s3]]

⥅ related node [[2010 09 06 twitter mentionmap by asterisq]]

⥅ related node [[2010 09 08 grow conference video interview]]

⥅ related node [[2010 11 02 movember 2010 and iqmetrix moustache alliance]]

⥅ related node [[2011 01 28 buying ponies from a drupal app store]]

⥅ related node [[2012 05 21 migration]]

⥅ related node [[2011 04 11 how to play instagram]]

⥅ related node [[2011 08 06 on coworking you cannot make a profit selling]]

⥅ related node [[2011 10 11 turning the corner on ebook buying]]

⥅ related node [[2011 11 26 we do need another rss hero]]

⥅ related node [[2011 12 02 struggles of an infovore that likes to share]]

⥅ related node [[2011 12 04 focus on the extras on your site rather than]]

⥅ related node [[2011 12 04 help startups by getting sht done or get out]]

⥅ related node [[2011 12 14 what support feedback service should you use]]

⥅ related node [[2012 02 02 reinventing the wheel one directory at a time]]

⥅ related node [[2012 02 05 i want to vote with my dollars that the vanco]]

⥅ related node [[2012 02 06 build more startups in vancouver]]

⥅ related node [[2012 02 12 what is an unconference]]

⥅ related node [[2012 03 15 cataloging city neighbourhood assets love my]]

⥅ related node [[2012 03 30 octopress all the things]]

⥅ related node [[2012 04 20 vancouver tech needs to wake up]]

⥅ related node [[2012 04 25 what im obsessed about]]

⥅ related node [[2012 05 07 services to product]]

⥅ related node [[2012 05 27 new hack stack]]

⥅ related node [[2012 06 02 node static site generators]]

⥅ related node [[2012 06 19 reactions microsoft surface]]

⥅ related node [[2012 06 29 posts you dont write]]

⥅ related node [[2012 07 01 setting up macbook air osx lion]]

⥅ related node [[2012 07 02 nv12 web literacy]]

⥅ related node [[2012 07 08 ssg lightning talk]]

⥅ related node [[2012 07 27 tracking qr codes]]

⥅ related node [[2012 08 10 calendaring tools]]

⥅ related node [[2012 08 11 startupriot seattle 2012]]

⥅ related node [[2012 09 04 working contractually]]

⥅ related node [[2012 11 09 ship your first version]]

⥅ related node [[2012 11 24 flickr question]]

⥅ related node [[2013 03 17 raw resources]]

⥅ related node [[2014 01 01 you cant outsource product]]

⥅ related node [[2014 06 04 early stage tech startup investing]]

⥅ related node [[2014 08 05 mavericks brew cask]]

⥅ related node [[2014 08 06 30 more years]]

⥅ related node [[2014 08 07 taking equity startups consulting]]

⥅ related node [[2014 08 15 harvesting knowledge]]

⥅ related node [[2014 11 09 vancouver tech civic election]]

⥅ related node [[2016 06 13 personal crm]]

⥅ related node [[2016 06 14 flickr to self hosted]]

⥅ related node [[2016 08 01 self hosting doesnt help self publish]]

⥅ related node [[2017 02 13 akasha cross post planting tag flag vancouver bowen canada]]

⥅ related node [[2017 02 19 archiving photos ios amazon s3]]

⥅ related node [[2017 04 09 run your own mastodon instance]]

⥅ related node [[2017 04 15 notes on running mastodon heroku]]

⥅ related node [[2017 08 19 blockchain open source definitions]]

⥅ related node [[2017 09 11 firesideconf barcamp spirit]]

⥅ related node [[2018 06 14 algiers smart city leapfrog tech]]

⥅ related node [[2018 07 01 berlin observations]]

⥅ related node [[2018 07 02 conferences as community gathering]]

⥅ related node [[2018 09 03 hello spade]]

⥅ related node [[2018 09 16 time crm tool update]]

⥅ related node [[2018 09 29 micro blog jekyll micro pub and indie web]]

⥅ related node [[2018 09 30 blockchain governance 101 vlad]]

⥅ related node [[2018 10 06 further thoughts on the fair]]

⥅ related node [[2018 10 11 commons based peer production]]

⥅ related node [[2019 01 01 flickr exports jekyll]]

⥅ related node [[2019 01 06 ethnews interview security token standards]]

⥅ related node [[2019 01 06 more flickr file experiments]]

⥅ related node [[2019 03 31 ethereum governance]]

⥅ related node [[2019 05 19 run your own web mentions]]

⥅ related node [[2019 05 21 model t indieweb]]

⥅ related node [[2019 05 22 drupal past predictions]]

⥅ related node [[2019 06 11 ipad tools]]

⥅ related node [[2020 01 03 cyberboats]]

⥅ related node [[2020 01 05 mennonites]]

⥅ related node [[2020 01 10 founder notes tam kbeili at]]

⥅ related node [[2020 01 13 the midlife crisis of the]]

⥅ related node [[2020 01 22 founder notes ehlist jan 2020 vancouver]]

⥅ related node [[2020 01 23 german startup ecosystem challenges canadian]]

⥅ related node [[2020 01 27 photo backup for geeks i os]]

⥅ related node [[2020 02 21 tools for home cooking]]

⥅ related node [[2020 02 25 laptop choices]]

⥅ related node [[2020 03 14 on instagram off facebook]]

⥅ related node [[2020 03 15 covid19 personal]]

⥅ related node [[2020 03 21 renting in pandemics]]

⥅ related node [[2020 03 22 oscms sunnyvale drupal]]

⥅ related node [[2020 03 31 onthisday wa state roadtrip]]

⥅ related node [[2020 04 20 readwriteweb wayback]]

⥅ related node [[2020 05 10 upgraded to indiekit micropub server]]

⥅ related node [[2020 05 14 so if all goes well]]

⥅ related node [[2020 07 04 new blog microblog]]

⥅ related node [[2020 10 08 joining social coop]]

⥅ related node [[2021 02 13 drop in audio]]

⥅ related node [[2021 02 14 remarkable tablet first usage]]

⥅ related node [[2021 03 07 back to indiekit]]

⥅ related node [[2021 03 14 moa party]]

⥅ related node [[boris popsicle]]

⥅ related node [[discord share sheet]]

⥅ related node [[neocities ipfs]]

⥅ related node [[mastodon bmann screenshot]]

⥅ related node [[socialcoop]]

⥅ related node [[corsair]]

⥅ related node [[corsair_diskutil]]

⥅ related node [[erase_corsair]]

⥅ related node [[format_options]]

⥅ related node [[owc_macmini_memory_screenshot]]

⥅ related node [[vantec]]

⥅ related node [[vantec_corsair_nvme]]

⥅ related node [[vantec_fit]]

⥅ related node [[bandcamp zia screenshot]]

⥅ related node [[obsidian graph 2020 10 01]]

⥅ related node [[git bug termui]]

⥅ related node [[git bug webui]]

⥅ related node [[remarkable templates]]

⥅ related node [[bmann_hair_orange_256x256]]

⥅ related node [[daniel abadia aowabhfa6bg unsplash]]

⥅ related node [[apple touch icon 114x114 precomposed]]

⥅ related node [[apple touch icon 120x120 precomposed]]

⥅ related node [[apple touch icon 144x144 precomposed]]

⥅ related node [[apple touch icon 152x152 precomposed]]

⥅ related node [[apple touch icon 180x180 precomposed]]

⥅ related node [[apple touch icon 72x72 precomposed]]

⥅ related node [[apple touch icon 76x76 precomposed]]

⥅ related node [[apple touch icon precomposed]]

⥅ related node [[context_menu]]

⥅ related node [[context_menu_backlinks]]

⥅ related node [[favicon 32x32]]

⥅ related node [[favicon]]

⥅ related node [[feed]]

⥅ related node [[firstdesign]]

⥅ related node [[fork_button]]

⥅ related node [[icon simplicity 512x512]]

⥅ related node [[msapplication_tileimage]]

⥅ related node [[ongoing]]

⥅ related node [[profile]]

⥅ related node [[profile_board]]

⥅ related node [[search]]

⥅ related node [[touch icon 192x192]]

⥅ related node [[22604b86dd]]

⥅ related node [[43762b4d36]]

⥅ related node [[5e6fe2c90b]]

⥅ related node [[999d04337d]]

⥅ related node [[ae1324bcbf]]

⥅ related node [[ba76d7ee41]]

⥅ related node [[cffa790d90]]

⥅ related node [[eee291fd35]]

⥅ related node [[screenshot 2019 05 02 16 43 42]]

⥅ related node [[11 pitch types]]

⥅ related node [[pitch structure ryan spoon]]

⥅ related node [[pitchdeckcoach]]

⥅ related node [[accounts]]

⥅ related node [[board of directors]]

⥅ related node [[compensation]]

⥅ related node [[convertible notes]]

⥅ related node [[corporation]]

⥅ related node [[equity accounts]]

⥅ related node [[equity]]

⥅ related node [[founder vesting]]

⥅ related node [[founder vs partner]]

⥅ related node [[general partnership]]

⥅ related node [[how to increase valuation pre revenue]]

⥅ related node [[how to organise the business]]

⥅ related node [[how to start a startup]]

⥅ related node [[limited (liability) partnership]]

⥅ related node [[limited liability company]]

⥅ related node [[partnership capital]]

⥅ related node [[partnership vs corporation]]

⥅ related node [[screenshot 2020 11 20 at 12 50 18 pm]]

⥅ related node [[setting up company in australia]]

⥅ related node [[shareholders]]

⥅ related node [[shares]]

⥅ related node [[stock clasees]]

⥅ related node [[stock options]]

⥅ related node [[tax laws india]]

⥅ related node [[100 reasons]]

⥅ related node [[11ty taxonomies]]

⥅ related node [[2021 11 12]]

⥅ related node [[2021 12 15]]

⥅ related node [[a domain much more]]

⥅ related node [[anagora coop]]

⥅ related node [[arch]]

⥅ related node [[as fast as possible]]

⥅ related node [[2021 11 27]]

⥅ related node [[pasted image 20210908234903]]

⥅ related node [[pasted image 20210908235646]]

⥅ related node [[pasted image 20210909000251]]

⥅ related node [[pasted image 20210909000558]]

⥅ related node [[pasted image 20210909001630]]

⥅ related node [[pasted image 20210909001733]]

⥅ related node [[pasted image 20210909001742]]

⥅ related node [[pasted image 20210909001802]]

⥅ related node [[pasted image 20210909001938]]

⥅ related node [[pasted image 20210909002024]]

⥅ related node [[pasted image 20210909002233]]

⥅ related node [[pasted image 20210909002454]]

⥅ related node [[pasted image 20210909002635]]

⥅ related node [[pasted image 20210909003148]]

⥅ related node [[pasted image 20210909012207]]

⥅ related node [[pasted image 20210925174631]]

⥅ related node [[pasted image 20210925174817]]

⥅ related node [[pasted image 20210925175116]]

⥅ related node [[pasted image 20210925175157]]

⥅ related node [[pasted image 20210925175259]]

⥅ related node [[pasted image 20210925175325]]

⥅ related node [[pasted image 20210925175359]]

⥅ related node [[pasted image 20210927015459]]

⥅ related node [[pasted image 20210927015524]]

⥅ related node [[pasted image 20210928211831]]

⥅ related node [[pasted image 20211011192755]]

⥅ related node [[pasted image 20211102001956]]

⥅ related node [[pasted image 20211102002528]]

⥅ related node [[pasted image 20211108224825]]

⥅ related node [[pasted image 20211114180923]]

⥅ related node [[pasted image 20211114181557]]

⥅ related node [[pasted image 20211114183310]]

⥅ related node [[pasted image 20211114222632]]

⥅ related node [[pasted image 20211114224043]]

⥅ related node [[pasted image 20211127120049]]

⥅ related node [[pasted image 20211127120130]]

⥅ related node [[pasted image 20211127123024]]

⥅ related node [[pasted image 20211127123137]]

⥅ related node [[pasted image 20211215003241]]

⥅ related node [[pasted image 20211215003642]]

⥅ related node [[shaman@2x]]

⥅ related node [[trinket@2x 3]]

⥅ related node [[v299b9agthoy3qd8tdz4gqelkmrgx9thp1z8]]

⥅ related node [[astro rfcs]]

⥅ related node [[astro s honeymoon phase]]

⥅ related node [[backpack]]

⥅ related node [[bias]]

⥅ related node [[blank paper syndrom]]

⥅ related node [[boehs]]

⥅ related node [[buying a lens]]

⥅ related node [[censorship]]

⥅ related node [[clickbait templates]]

⥅ related node [[clone a linux system install to another computer]]

⥅ related node [[community values]]

⥅ related node [[companies using open collective]]

⥅ related node [[cors]]

⥅ related node [[crown and shield and mop and bucket]]

⥅ related node [[do good resources]]

⥅ related node [[do good]]

⥅ related node [[domain]]

⥅ related node [[don t vote for]]

⥅ related node [[drew devault]]

⥅ related node [[dunkin]]

⥅ related node [[expertise]]

⥅ related node [[faang]]

⥅ related node [[flancia chats]]

⥅ related node [[flania]]

⥅ related node [[for me not you]]

⥅ related node [[fuck cars]]

⥅ related node [[fucking cars faq]]

⥅ related node [[garden representations]]

⥅ related node [[get on my level]]

⥅ related node [[github considered harmful]]

⥅ related node [[good tlds]]

⥅ related node [[google]]

⥅ related node [[hater]]

⥅ related node [[honk]]

⥅ related node [[html notes]]

⥅ related node [[i hate that i love piracy]]

⥅ related node [[inclusive vs restrictive]]

⥅ related node [[interesting websites]]

⥅ related node [[interledger]]

⥅ related node [[is altruism a religion]]

⥅ related node [[is it working]]

⥅ related node [[iwlep]]

⥅ related node [[japan]]

⥅ related node [[javascript]]

⥅ related node [[journey]]

⥅ related node [[khan]]

⥅ related node [[ki]]

⥅ related node [[last]]

⥅ related node [[lemmy what i want 1]]

⥅ related node [[lens list]]

⥅ related node [[linked web]]

⥅ related node [[lip]]

⥅ related node [[live life]]

⥅ related node [[lorum]]

⥅ related node [[me stack]]

⥅ related node [[missing free space in windows partion manager]]

⥅ related node [[motd]]

⥅ related node [[musicbee]]

⥅ related node [[names]]

⥅ related node [[nft]]

⥅ related node [[nine wishes]]

⥅ related node [[no reviews]]

⥅ related node [[not included]]

⥅ related node [[astro defer]]

⥅ related node [[astro dot compile]]

⥅ related node [[custom elements]]

⥅ related node [[escaped and raw components]]

⥅ related node [[rfc template]]

⥅ related node [[obsidian publish]]

⥅ related node [[on marak]]

⥅ related node [[on web browsers]]

⥅ related node [[open source docs]]

⥅ related node [[penny]]

⥅ related node [[penpen]]

⥅ related node [[people i have blocked]]

⥅ related node [[perfection]]

⥅ related node [[photography]]

⥅ related node [[present]]

⥅ related node [[proficiency]]

⥅ related node [[program lang master list]]

⥅ related node [[push]]

⥅ related node [[regex magic]]

⥅ related node [[response to flancian 1]]

⥅ related node [[rfc early feedback first class support for backend frameworks]]

⥅ related node [[rust rolling review]]

⥅ related node [[rust 🦀]]

⥅ related node [[salting]]

⥅ related node [[secular humanism vs atheism]]

⥅ related node [[server]]

⥅ related node [[shorts]]

⥅ related node [[significance]]

⥅ related node [[ski patrol sets the tune]]

⥅ related node [[songs to download higher quality]]

⥅ related node [[spellcheck]]

⥅ related node [[syncthing]]

⥅ related node [[teach to fish]]

⥅ related node [[the tech trap]]

⥅ related node [[the garden and the stream]]

⥅ related node [[the higherarchy problem]]

⥅ related node [[the me stack]]

⥅ related node [[things i hate]]

⥅ related node [[things i want to do]]

⥅ related node [[things i want to learn]]

⥅ related node [[trail]]

⥅ related node [[untitled]]

⥅ related node [[videos]]

⥅ related node [[we all are lazy]]

⥅ related node [[we live in a society]]

⥅ related node [[website]]

⥅ related node [[what makes a male]]

⥅ related node [[when banks fail]]

⥅ related node [[why]]

⥅ related node [[wikilinks everywhere]]

⥅ related node [[wikilinks]]

⥅ related node [[wikipedia]]

⥅ related node [[wonk]]

⥅ related node [[日本]]

⥅ related node [[flancia]]

⥅ related node [[tesla2_lg]]

⥅ related node [[tesla4_lg]]

⥅ related node [[tesla_conducts_lg]]

⥅ related node [[tesla_lightning1_lg]]

⥅ related node [[tesla_lightning2_lg]]

⥅ related node [[tesla_tower1_lg]]

⥅ related node [[17]]

⥅ related node [[botginia]]

⥅ related node [[fiction]]

⥅ related node [[go]]

⥅ related node [[goals]]

⥅ related node [[home]]

⥅ related node [[irchelpark]]

⥅ related node [[manifesto]]

⥅ related node [[meet]]

⥅ related node [[meta]]

⥅ related node [[one day]]

⥅ related node [[others]]

⥅ related node [[plan]]

⥅ related node [[poverty]]

⥅ related node [[privilege]]

⥅ related node [[relics]]

⥅ related node [[simulation]]

⥅ related node [[way]]

⥅ related node [[1 buddha n bodhisattvas]]

⥅ related node [[2019 01 26]]

⥅ related node [[2019 02 03]]

⥅ related node [[2019 03 04]]

⥅ related node [[2019 03 18]]

⥅ related node [[2019 04 14]]

⥅ related node [[2019 09 21]]

⥅ related node [[2020]]

⥅ related node [[2022 03 26]]

⥅ related node [[a new corporation type]]

⥅ related node [[about unicorns in south america]]

⥅ related node [[bad showers]]

⥅ related node [[barcelona]]

⥅ related node [[beatboxing]]

⥅ related node [[best url of 2014]]

⥅ related node [[blockchain]]

⥅ related node [[bologna]]

⥅ related node [[bootlegs]]

⥅ related node [[cannazon]]

⥅ related node [[cano]]

⥅ related node [[chandler]]

⥅ related node [[chrome 21803362129]]

⥅ related node [[consciousness]]

⥅ related node [[cover]]

⥅ related node [[drafts]]

⥅ related node [[dreams]]

⥅ related node [[embracing piracy]]

⥅ related node [[ethics]]

⥅ related node [[evolution]]

⥅ related node [[experiments with replicating elements of style with transformer]]

⥅ related node [[flanbook]]

⥅ related node [[flying]]

⥅ related node [[foreground]]

⥅ related node [[friction]]

⥅ related node [[german]]

⥅ related node [[go links]]

⥅ related node [[gwern]]

⥅ related node [[history chrome extension]]

⥅ related node [[hotels]]

⥅ related node [[how to beat procrastination]]

⥅ related node [[ideas]]

⥅ related node [[in favour of identity politics]]

⥅ related node [[kallax]]

⥅ related node [[la vida de evaldo]]

⥅ related node [[last days]]

⥅ related node [[machine learning]]

⥅ related node [[meditation for programmers]]

⥅ related node [[meditation practice]]

⥅ related node [[memory]]

⥅ related node [[metta]]

⥅ related node [[minsky]]

⥅ related node [[more on gpt 2]]

⥅ related node [[music as meditation]]

⥅ related node [[music]]

⥅ related node [[nikola]]

⥅ related node [[on writing]]

⥅ related node [[ontological coaching]]

⥅ related node [[overfitting]]

⥅ related node [[pearson]]

⥅ related node [[philosophy]]

⥅ related node [[politics]]

⥅ related node [[procrastination]]

⥅ related node [[ramen]]

⥅ related node [[rnns]]

⥅ related node [[scaruffi]]

⥅ related node [[space time]]

⥅ related node [[stoa]]

⥅ related node [[strange finger]]

⥅ related node [[the random seller]]

⥅ related node [[time capsules]]

⥅ related node [[time]]

⥅ related node [[towards the agora]]

⥅ related node [[twitter]]

⥅ related node [[two feature requests for google keep]]

⥅ related node [[why we did it]]

⥅ related node [[writing]]

⥅ related node [[youtube]]

⥅ related node [[license]]

⥅ related node [[book 180x120]]

⥅ related node [[book 180x270]]

⥅ related node [[link 180x120]]

⥅ related node [[controls]]

⥅ related node [[loading]]

⥅ related node [[close]]

⥅ related node [[next]]

⥅ related node [[prev]]

⥅ related node [[blue mocha grunge]]

⥅ related node [[cream dust]]

⥅ related node [[glyphicons halflings white]]

⥅ related node [[glyphicons halflings]]

⥅ related node [[0 5 6]]

⥅ related node [[007bistromath]]

⥅ related node [[04ad55534a8a4b70a4f16c3a9c710d75]]

⥅ related node [[05521f1c195d4fb28117d3bdebdf9c91]]

⥅ related node [[0oo li]]

⥅ related node [[0x49fa98]]

⥅ related node [[1 rule]]

⥅ related node [[1*]]

⥅ related node [[10 minute breathwork]]

⥅ related node [[10 papers every developer should read at least twice]]

⥅ related node [[11]]

⥅ related node [[119]]

⥅ related node [[11am]]

⥅ related node [[13 4]]

⥅ related node [[13 minutes]]

⥅ related node [[13 sentinels aegis rim]]

⥅ related node [[13]]

⥅ related node [[131]]

⥅ related node [[13e4c4ff6674e94819e7b22bac56e91645a9b389]]

⥅ related node [[15 minutes]]

⥅ related node [[1657 effect]]

⥅ related node [[1657]]

⥅ related node [[17 40]]

⥅ related node [[173]]

⥅ related node [[197]]

⥅ related node [[1989 chilean grape scare]]

⥅ related node [[1c3]]

⥅ related node [[1c3k1n9]]

⥅ related node [[20 pager]]

⥅ related node [[2000]]

⥅ related node [[2000s]]

⥅ related node [[2004 update]]

⥅ related node [[2012 05 27]]

⥅ related node [[2019 update]]

⥅ related node [[2020 04 03]]

⥅ related node [[2020 04 05]]

⥅ related node [[2020 04 06]]

⥅ related node [[2020 04 07]]

⥅ related node [[2020 04 09]]

⥅ related node [[2020 04 10]]

⥅ related node [[2020 04 11]]

⥅ related node [[2020 04 12]]

⥅ related node [[2020 04 13]]

⥅ related node [[2020 04 17]]

⥅ related node [[2020 04 18]]

⥅ related node [[2020 04 19]]

⥅ related node [[2020 04 22]]

⥅ related node [[2020 04 23]]

⥅ related node [[2020 04 24]]

⥅ related node [[2020 04 25]]

⥅ related node [[2020 04 26]]

⥅ related node [[2020 04 27]]

⥅ related node [[2020 05 01]]

⥅ related node [[2020 05 02]]

⥅ related node [[2020 05 03]]

⥅ related node [[2020 05 04]]

⥅ related node [[2020 05 05]]

⥅ related node [[2020 05 06]]

⥅ related node [[2020 05 07]]

⥅ related node [[2020 05 08]]

⥅ related node [[2020 05 09]]

⥅ related node [[2020 05 10]]

⥅ related node [[2020 05 15]]

⥅ related node [[2020 05 16]]

⥅ related node [[2020 05 17]]

⥅ related node [[2020 05 18]]

⥅ related node [[2020 05 19]]

⥅ related node [[2020 05 20]]

⥅ related node [[2020 05 21]]

⥅ related node [[2020 05 22]]

⥅ related node [[2020 05 23]]

⥅ related node [[2020 05 24]]

⥅ related node [[2020 06 01]]

⥅ related node [[2020 06 02]]

⥅ related node [[2020 06 03]]

⥅ related node [[2020 06 04]]

⥅ related node [[2020 06 06]]

⥅ related node [[2020 06 07]]

⥅ related node [[2020 06 08]]

⥅ related node [[2020 06 09]]

⥅ related node [[2020 06 10]]

⥅ related node [[2020 06 11]]

⥅ related node [[2020 06 12]]

⥅ related node [[2020 06 13]]

⥅ related node [[2020 06 14]]

⥅ related node [[2020 06 15]]

⥅ related node [[2020 06 16]]

⥅ related node [[2020 06 17]]

⥅ related node [[2020 06 18]]

⥅ related node [[2020 06 19]]

⥅ related node [[2020 06 20]]

⥅ related node [[2020 06 21]]

⥅ related node [[2020 06 24]]

⥅ related node [[2020 06 27]]

⥅ related node [[2020 06 28]]

⥅ related node [[2020 06 29]]

⥅ related node [[2020 07 04]]

⥅ related node [[2020 07 05]]

⥅ related node [[2020 07 06]]

⥅ related node [[2020 07 07]]

⥅ related node [[2020 07 08]]

⥅ related node [[2020 07 09]]

⥅ related node [[2020 07 10]]

⥅ related node [[2020 07 11]]

⥅ related node [[2020 07 12]]

⥅ related node [[2020 07 14]]

⥅ related node [[2020 07 15]]

⥅ related node [[2020 07 16]]

⥅ related node [[2020 07 17]]

⥅ related node [[2020 07 18]]

⥅ related node [[2020 07 19]]

⥅ related node [[2020 07 20]]

⥅ related node [[2020 07 21]]

⥅ related node [[2020 07 22]]

⥅ related node [[2020 07 23]]

⥅ related node [[2020 07 24]]

⥅ related node [[2020 07 25]]

⥅ related node [[2020 07 26]]

⥅ related node [[2020 07 27]]

⥅ related node [[2020 07 29]]

⥅ related node [[2020 07 30]]

⥅ related node [[2020 07 31]]

⥅ related node [[2020 08 01]]

⥅ related node [[2020 08 02]]

⥅ related node [[2020 08 03]]

⥅ related node [[2020 08 04]]

⥅ related node [[2020 08 05]]

⥅ related node [[2020 08 06]]

⥅ related node [[2020 08 07]]

⥅ related node [[2020 08 08]]

⥅ related node [[2020 08 09]]

⥅ related node [[2020 08 10]]

⥅ related node [[2020 08 11]]

⥅ related node [[2020 08 12]]

⥅ related node [[2020 08 13]]

⥅ related node [[2020 08 14]]

⥅ related node [[2020 08 15]]

⥅ related node [[2020 08 16]]

⥅ related node [[2020 08 17]]

⥅ related node [[2020 08 18]]

⥅ related node [[2020 08 19]]

⥅ related node [[2020 08 20]]

⥅ related node [[2020 08 21]]

⥅ related node [[2020 08 22]]

⥅ related node [[2020 08 23]]

⥅ related node [[2020 08 24]]

⥅ related node [[2020 08 25]]

⥅ related node [[2020 08 26]]

⥅ related node [[2020 08 27]]

⥅ related node [[2020 08 28]]

⥅ related node [[2020 08 29]]

⥅ related node [[2020 08 30]]

⥅ related node [[2020 08 31]]

⥅ related node [[2020 09 01]]

⥅ related node [[2020 09 02]]

⥅ related node [[2020 09 03]]

⥅ related node [[2020 09 04]]

⥅ related node [[2020 09 05]]

⥅ related node [[2020 09 06]]

⥅ related node [[2020 09 07]]

⥅ related node [[2020 09 08]]

⥅ related node [[2020 09 09]]

⥅ related node [[2020 09 10]]

⥅ related node [[2020 09 11]]

⥅ related node [[2020 09 12]]

⥅ related node [[2020 09 13]]

⥅ related node [[2020 09 14]]

⥅ related node [[2020 09 15]]

⥅ related node [[2020 09 16]]

⥅ related node [[2020 09 17]]

⥅ related node [[2020 09 18]]

⥅ related node [[2020 09 19]]

⥅ related node [[2020 09 20]]

⥅ related node [[2020 09 21]]

⥅ related node [[2020 09 22]]

⥅ related node [[2020 09 23]]

⥅ related node [[2020 09 24]]

⥅ related node [[2020 09 25]]

⥅ related node [[2020 09 26]]

⥅ related node [[2020 09 27]]

⥅ related node [[2020 09 28]]

⥅ related node [[2020 09 29]]

⥅ related node [[2020 09 30]]

⥅ related node [[2020 10 01]]

⥅ related node [[2020 10 02]]

⥅ related node [[2020 10 03]]

⥅ related node [[2020 10 04]]

⥅ related node [[2020 10 05]]

⥅ related node [[2020 10 06]]

⥅ related node [[2020 10 07]]

⥅ related node [[2020 10 08]]

⥅ related node [[2020 10 09]]

⥅ related node [[2020 10 10]]

⥅ related node [[2020 10 11]]

⥅ related node [[2020 10 12]]

⥅ related node [[2020 10 13]]

⥅ related node [[2020 10 14]]

⥅ related node [[2020 10 15]]

⥅ related node [[2020 10 16]]

⥅ related node [[2020 10 17]]

⥅ related node [[2020 10 18]]

⥅ related node [[2020 10 19]]

⥅ related node [[2020 10 20]]

⥅ related node [[2020 10 21]]

⥅ related node [[2020 10 22]]

⥅ related node [[2020 10 23]]

⥅ related node [[2020 10 24]]

⥅ related node [[2020 10 25]]

⥅ related node [[2020 10 26]]

⥅ related node [[2020 10 27]]

⥅ related node [[2020 10 28]]

⥅ related node [[2020 10 29]]

⥅ related node [[2020 10 30]]

⥅ related node [[2020 10 31]]

⥅ related node [[2020 11 01]]

⥅ related node [[2020 11 02]]

⥅ related node [[2020 11 03]]

⥅ related node [[2020 11 04]]

⥅ related node [[2020 11 05]]

⥅ related node [[2020 11 06]]

⥅ related node [[2020 11 07]]

⥅ related node [[2020 11 08]]

⥅ related node [[2020 11 09]]

⥅ related node [[2020 11 10]]

⥅ related node [[2020 11 11]]

⥅ related node [[2020 11 12]]

⥅ related node [[2020 11 13]]

⥅ related node [[2020 11 14]]

⥅ related node [[2020 11 16]]

⥅ related node [[2020 11 17]]

⥅ related node [[2020 11 18]]

⥅ related node [[2020 11 19]]

⥅ related node [[2020 11 20]]

⥅ related node [[2020 11 21]]

⥅ related node [[2020 11 22]]

⥅ related node [[2020 11 23]]

⥅ related node [[2020 11 24]]

⥅ related node [[2020 11 25]]

⥅ related node [[2020 11 26]]

⥅ related node [[2020 11 27]]

⥅ related node [[2020 11 28]]

⥅ related node [[2020 11 29]]

⥅ related node [[2020 11 30]]

⥅ related node [[2020 12 01]]

⥅ related node [[2020 12 02]]

⥅ related node [[2020 12 03]]

⥅ related node [[2020 12 04]]

⥅ related node [[2020 12 05]]

⥅ related node [[2020 12 06]]

⥅ related node [[2020 12 07]]

⥅ related node [[2020 12 08]]

⥅ related node [[2020 12 09]]

⥅ related node [[2020 12 10]]

⥅ related node [[2020 12 11]]

⥅ related node [[2020 12 12]]

⥅ related node [[2020 12 13]]

⥅ related node [[2020 12 14]]

⥅ related node [[2020 12 15]]

⥅ related node [[2020 12 16]]

⥅ related node [[2020 12 17]]

⥅ related node [[2020 12 18]]

⥅ related node [[2020 12 19]]

⥅ related node [[2020 12 20]]

⥅ related node [[2020 12 21]]

⥅ related node [[2020 12 22]]

⥅ related node [[2020 12 23]]

⥅ related node [[2020 12 24]]

⥅ related node [[2020 12 25]]

⥅ related node [[2020 12 26]]

⥅ related node [[2020 12 27]]

⥅ related node [[2020 12 28]]

⥅ related node [[2020 12 29]]

⥅ related node [[2020 12 30]]

⥅ related node [[2020 12 31]]

⥅ related node [[2021 eneri]]

⥅ related node [[2021 storming of the united states capitol]]

⥅ related node [[2021 01 01]]

⥅ related node [[2021 01 02]]

⥅ related node [[2021 01 03]]

⥅ related node [[2021 01 04]]

⥅ related node [[2021 01 05]]

⥅ related node [[2021 01 06]]

⥅ related node [[2021 01 07]]

⥅ related node [[2021 01 08]]

⥅ related node [[2021 01 09]]

⥅ related node [[2021 01 10]]

⥅ related node [[2021 01 11]]

⥅ related node [[2021 01 12]]

⥅ related node [[2021 01 13]]

⥅ related node [[2021 01 14]]

⥅ related node [[2021 01 15]]

⥅ related node [[2021 01 16]]

⥅ related node [[2021 01 17]]

⥅ related node [[2021 01 18]]

⥅ related node [[2021 01 19]]

⥅ related node [[2021 01 20]]

⥅ related node [[2021 01 21]]

⥅ related node [[2021 01 22]]

⥅ related node [[2021 01 23]]

⥅ related node [[2021 01 24]]

⥅ related node [[2021 01 25]]

⥅ related node [[2021 01 26]]

⥅ related node [[2021 01 27]]

⥅ related node [[2021 01 28]]

⥅ related node [[2021 01 29]]

⥅ related node [[2021 01 30]]

⥅ related node [[2021 01 31]]

⥅ related node [[2021 02 01]]

⥅ related node [[2021 02 02]]

⥅ related node [[2021 02 03]]

⥅ related node [[2021 02 04]]

⥅ related node [[2021 02 05]]

⥅ related node [[2021 02 06]]

⥅ related node [[2021 02 07]]

⥅ related node [[2021 02 08]]

⥅ related node [[2021 02 09]]

⥅ related node [[2021 02 10]]

⥅ related node [[2021 02 11]]

⥅ related node [[2021 02 12]]

⥅ related node [[2021 02 13]]

⥅ related node [[2021 02 14]]

⥅ related node [[2021 02 15]]

⥅ related node [[2021 02 16]]

⥅ related node [[2021 02 17]]

⥅ related node [[2021 02 18]]

⥅ related node [[2021 02 19]]

⥅ related node [[2021 02 20]]

⥅ related node [[2021 02 21]]

⥅ related node [[2021 03 10]]

⥅ related node [[2021 03 16]]

⥅ related node [[2021 03 17]]

⥅ related node [[2021 03 26]]

⥅ related node [[2021 03 29]]

⥅ related node [[2021 03 31]]

⥅ related node [[2021 04 01]]

⥅ related node [[2021 04 02]]

⥅ related node [[2021 04 03]]

⥅ related node [[2021 04 06]]

⥅ related node [[2021 04 08]]

⥅ related node [[2021 04 09]]

⥅ related node [[2021 04 10]]

⥅ related node [[2021 04 11]]

⥅ related node [[2021 04 12]]

⥅ related node [[2021 04 13]]

⥅ related node [[2021 04 14]]

⥅ related node [[2021 04 15]]

⥅ related node [[2021 04 16]]

⥅ related node [[2021 04 17]]

⥅ related node [[2021 04 18]]

⥅ related node [[2021 04 19]]

⥅ related node [[2021 04 21]]

⥅ related node [[2021 04 22]]

⥅ related node [[2021 04 23]]

⥅ related node [[2021 04 27]]

⥅ related node [[2021 04 28]]

⥅ related node [[2021 04 29]]

⥅ related node [[2021 04 30]]

⥅ related node [[2021 05 01]]

⥅ related node [[2021 05 02]]

⥅ related node [[2021 05 03]]

⥅ related node [[2021 05 04]]

⥅ related node [[2021 05 05]]

⥅ related node [[2021 05 06]]

⥅ related node [[2021 05 07]]

⥅ related node [[2021 05 08]]

⥅ related node [[2021 05 09]]

⥅ related node [[2021 05 10]]

⥅ related node [[2021 05 12]]

⥅ related node [[2021 05 13]]

⥅ related node [[2021 05 14]]

⥅ related node [[2021 05 15]]

⥅ related node [[2021 05 16]]

⥅ related node [[2021 05 17]]

⥅ related node [[2021 05 19]]

⥅ related node [[2021 05 20]]

⥅ related node [[2021 05 21]]

⥅ related node [[2021 05 22 172254_668x1032_scrot]]

⥅ related node [[2021 05 22]]

⥅ related node [[2021 05 23]]

⥅ related node [[2021 05 24]]

⥅ related node [[2021 05 25]]

⥅ related node [[2021 05 26]]

⥅ related node [[2021 05 27]]

⥅ related node [[2021 05 28]]

⥅ related node [[2021 05 29]]

⥅ related node [[2021 05 30]]

⥅ related node [[2021 05 31]]

⥅ related node [[2021 06 01]]

⥅ related node [[2021 06 02]]

⥅ related node [[2021 06 03]]

⥅ related node [[2021 06 04]]

⥅ related node [[2021 06 05]]

⥅ related node [[2021 06 06]]

⥅ related node [[2021 06 07]]

⥅ related node [[2021 06 09]]

⥅ related node [[2021 06 10]]

⥅ related node [[2021 06 11]]

⥅ related node [[2021 06 12]]

⥅ related node [[2021 06 13]]

⥅ related node [[2021 06 14]]

⥅ related node [[2021 06 15]]

⥅ related node [[2021 06 16]]

⥅ related node [[2021 06 18]]

⥅ related node [[2021 06 19]]

⥅ related node [[2021 06 20]]

⥅ related node [[2021 06 22]]

⥅ related node [[2021 06 23]]

⥅ related node [[2021 06 24]]

⥅ related node [[2021 06 25]]

⥅ related node [[2021 06 26]]

⥅ related node [[2021 06 27]]

⥅ related node [[2021 06 28]]

⥅ related node [[2021 06 29]]

⥅ related node [[2021 06 30]]

⥅ related node [[2021 07 01]]

⥅ related node [[2021 07 02]]

⥅ related node [[2021 07 03]]

⥅ related node [[2021 07 04]]

⥅ related node [[2021 07 05]]

⥅ related node [[2021 07 06]]

⥅ related node [[2021 07 07]]

⥅ related node [[2021 07 08]]

⥅ related node [[2021 07 09]]

⥅ related node [[2021 07 10]]

⥅ related node [[2021 07 11]]

⥅ related node [[2021 07 12]]

⥅ related node [[2021 07 13]]

⥅ related node [[2021 07 14]]

⥅ related node [[2021 07 15]]

⥅ related node [[2021 07 16]]

⥅ related node [[2021 07 17]]

⥅ related node [[2021 07 18]]

⥅ related node [[2021 07 19]]

⥅ related node [[2021 07 20]]

⥅ related node [[2021 07 21]]

⥅ related node [[2021 07 22]]

⥅ related node [[2021 07 23]]

⥅ related node [[2021 07 24]]

⥅ related node [[2021 07 25]]

⥅ related node [[2021 07 27]]

⥅ related node [[2021 07 28]]

⥅ related node [[2021 07 30]]

⥅ related node [[2021 07 31]]

⥅ related node [[2021 08 19]]

⥅ related node [[2021 08 27 12 50 38]]

⥅ related node [[2021 09 14]]

⥅ related node [[2021 09 21]]

⥅ related node [[2021 10 12]]

⥅ related node [[2022 10 30]]

⥅ related node [[2022 resolutions]]

⥅ related node [[2022 01]]

⥅ related node [[2022 02 19 234224_1053x258_scrot]]

⥅ related node [[2022 w01]]

⥅ related node [[202202]]

⥅ related node [[2022 02 13]]

⥅ related node [[2023 07 27]]

⥅ related node [[2023]]

⥅ related node [[2024 02 19]]

⥅ related node [[2024 02 24]]

⥅ related node [[2024 03 08]]

⥅ related node [[2024 03 09]]

⥅ related node [[2024 03 10t18 49 23 436855554 01 00]]

⥅ related node [[2024 05 01]]

⥅ related node [[2024 05 04t01 01 08 115669313 02 00]]

⥅ related node [[2024 05 10]]

⥅ related node [[2024 05 28]]

⥅ related node [[2024 06 10]]

⥅ related node [[2024 06 14]]

⥅ related node [[2024 06 14t16 18 08 984568739 02 00]]

⥅ related node [[2024 06 21]]

⥅ related node [[2024 06 22]]

⥅ related node [[2024 06 23]]

⥅ related node [[2024 07 12]]

⥅ related node [[2024 07 14]]

⥅ related node [[2024 07 16]]

⥅ related node [[2024 07 17]]

⥅ related node [[2024 07 20]]

⥅ related node [[2024 07 21 conflicted 1721582925825]]

⥅ related node [[2024 07 21 conflicted 1721588864341]]

⥅ related node [[2024 07 21 conflicted 1721593620132]]

⥅ related node [[2024 07 21]]

⥅ related node [[2024 07 22]]

⥅ related node [[2024 07 31]]

⥅ related node [[2024 08 01]]

⥅ related node [[2024 08 03]]

⥅ related node [[2024 08 08]]

⥅ related node [[2024 08 10 conflicted 1723306096826]]

⥅ related node [[2024 08 10]]

⥅ related node [[2024 08 11]]

⥅ related node [[2024 08 12]]

⥅ related node [[2024 08 13]]

⥅ related node [[2024 08 15]]

⥅ related node [[2024 08 16]]

⥅ related node [[2024 08 17]]

⥅ related node [[2024 08 18]]

⥅ related node [[2024 08 19]]

⥅ related node [[2024 08 22]]

⥅ related node [[2024 08 28]]

⥅ related node [[2024 08 29]]

⥅ related node [[2024 09 02]]

⥅ related node [[2024 09 03]]

⥅ related node [[2024 09 05]]

⥅ related node [[2024 09 06]]

⥅ related node [[2024 09 14]]

⥅ related node [[2024 09 21]]

⥅ related node [[2024 09 24]]

⥅ related node [[2024 09 27]]

⥅ related node [[2024 09 28]]

⥅ related node [[2024 09 30]]

⥅ related node [[2024 10 01]]

⥅ related node [[2024 10 04]]

⥅ related node [[2024 10 06]]

⥅ related node [[2024 10 08]]

⥅ related node [[2024 10 11]]

⥅ related node [[2024 10 12]]

⥅ related node [[2024 10 15]]

⥅ related node [[2024 10 17]]

⥅ related node [[2024 10 19]]

⥅ related node [[2024 10 20]]

⥅ related node [[2024 10 21]]

⥅ related node [[2024 10 24]]

⥅ related node [[2024 10 25]]

⥅ related node [[2024 10 26]]

⥅ related node [[2024 10 27]]

⥅ related node [[2024 10 28]]

⥅ related node [[2024 10 29]]

⥅ related node [[2024 10 31]]

⥅ related node [[2024 11 01]]

⥅ related node [[2024 11 02]]

⥅ related node [[2024 11 03]]

⥅ related node [[2024 11 04]]

⥅ related node [[2024 11 05]]

⥅ related node [[2024 11 06]]

⥅ related node [[2024 11 08]]

⥅ related node [[2024 11 09]]

⥅ related node [[2024 11 10]]

⥅ related node [[2024 11 11]]

⥅ related node [[2024 11 15]]

⥅ related node [[2024 11 16]]

⥅ related node [[2024 11 17]]

⥅ related node [[2024 11 19]]

⥅ related node [[2024 11 20]]

⥅ related node [[2024 11 22]]

⥅ related node [[2024 11 23]]

⥅ related node [[2024 11 24]]

⥅ related node [[2024 11 27]]

⥅ related node [[2024 11 28]]

⥅ related node [[2024 11 30]]

⥅ related node [[2024 12 02]]

⥅ related node [[2024 12 06]]

⥅ related node [[2024 12 08]]

⥅ related node [[2024 12 13]]

⥅ related node [[2024 12 15]]

⥅ related node [[2024 12 21]]

⥅ related node [[2024 12 23]]

⥅ related node [[2024 12 24]]

⥅ related node [[2024 12 26]]

⥅ related node [[2024 12 27]]

⥅ related node [[2024 12 28]]

⥅ related node [[2024 12 29]]

⥅ related node [[2025 01 01]]

⥅ related node [[2025 01 03]]

⥅ related node [[2025 01 04]]

⥅ related node [[2025 01 06]]

⥅ related node [[2025 01 08]]

⥅ related node [[2025 01 09]]

⥅ related node [[2025 01 10]]

⥅ related node [[2025 01 11]]

⥅ related node [[2025 01 12]]

⥅ related node [[2025 01 13]]

⥅ related node [[2025 01 16]]

⥅ related node [[2025 01 17]]

⥅ related node [[2025 01 18]]

⥅ related node [[2025 01 19]]

⥅ related node [[2025 01 21 md]]

⥅ related node [[2025 01 25]]

⥅ related node [[2025 01 26]]

⥅ related node [[2025 01 27]]

⥅ related node [[2025 01 28]]

⥅ related node [[2025 02 05]]

⥅ related node [[2025 02 09]]

⥅ related node [[2025 03 03]]

⥅ related node [[2025 03 09]]

⥅ related node [[2025 03 10]]

⥅ related node [[2025 03 11]]

⥅ related node [[2025 03 12]]

⥅ related node [[2025 03 13]]

⥅ related node [[2025 03 14]]

⥅ related node [[2025 03 15]]

⥅ related node [[2025 03 16]]

⥅ related node [[2025 03 19]]

⥅ related node [[2025 03 20]]

⥅ related node [[2025 03 21]]

⥅ related node [[2025 03 22]]

⥅ related node [[2025 03 23]]

⥅ related node [[2025 03 29]]

⥅ related node [[2025 03 30]]

⥅ related node [[2025 03 31]]

⥅ related node [[2025 04 01]]

⥅ related node [[2025 04 02]]

⥅ related node [[2025 04 08]]

⥅ related node [[2025 04 11]]

⥅ related node [[2025 04 13]]

⥅ related node [[2025 04 17]]

⥅ related node [[2025 04 18]]

⥅ related node [[2025 04 19]]

⥅ related node [[2025 04 21]]

⥅ related node [[2025 04 25]]

⥅ related node [[2025 04 29]]

⥅ related node [[2025 04 30]]

⥅ related node [[2025 05 02]]

⥅ related node [[2025 05 06]]

⥅ related node [[2025 05 09]]

⥅ related node [[2025 05 17]]

⥅ related node [[2025 05 18]]

⥅ related node [[2025 05 19]]

⥅ related node [[2025 05 20]]

⥅ related node [[2025 05 21]]

⥅ related node [[2025 05 28]]

⥅ related node [[2025 05 31]]

⥅ related node [[2025 06 12]]

⥅ related node [[2025 06 18]]

⥅ related node [[2025 06 21]]

⥅ related node [[2025 06 23]]

⥅ related node [[2025 06 28]]

⥅ related node [[2025 07 12]]

⥅ related node [[2025 07 13]]

⥅ related node [[2025 07 16]]

⥅ related node [[2025 07 21]]

⥅ related node [[2025 07 23]]

⥅ related node [[2025 07 31]]

⥅ related node [[2025 08 01]]

⥅ related node [[2025 08 04]]

⥅ related node [[2025 08 06]]

⥅ related node [[2025 08 16]]

⥅ related node [[2025 08 18]]

⥅ related node [[2025 08 21]]

⥅ related node [[2025 08 28]]

⥅ related node [[2025 08 29]]

⥅ related node [[2025 09 10]]

⥅ related node [[2025 09 21]]

⥅ related node [[2025 09 27]]

⥅ related node [[2025 10 03]]

⥅ related node [[2025 10 05]]

⥅ related node [[2025 10 09]]

⥅ related node [[2025 10 10]]

⥅ related node [[2025 10 23]]

⥅ related node [[2025 10 26]]

⥅ related node [[2025 10 27]]

⥅ related node [[2025 10 28]]

⥅ related node [[2025 11 12]]

⥅ related node [[2025 11 29]]

⥅ related node [[2025 12 01]]

⥅ related node [[2025 12 13]]

⥅ related node [[2025 12 14]]

⥅ related node [[2025]]

⥅ related node [[2047]]

⥅ related node [[2048]]

⥅ related node [[20th anniversary of the founder s letter]]

⥅ related node [[21st century]]

⥅ related node [[22]]

⥅ related node [[2310]]

⥅ related node [[249]]

⥅ related node [[25]]

⥅ related node [[27]]

⥅ related node [[29]]

⥅ related node [[2d barcodes]]

⥅ related node [[3 agora]]

⥅ related node [[30 days of yoga]]

⥅ related node [[30]]

⥅ related node [[301]]

⥅ related node [[301works]]

⥅ related node [[311]]

⥅ related node [[37 practices of bodhisattvas]]

⥅ related node [[37]]

⥅ related node [[39b7e4a634104317843b0cc72ac479a1]]

⥅ related node [[3d printed concrete]]

⥅ related node [[3np]]

⥅ related node [[3wc]]

⥅ related node [[406]]

⥅ related node [[420 wedding]]

⥅ related node [[476]]

⥅ related node [[50 minute pomodoro]]

⥅ related node [[501c]]

⥅ related node [[55]]

⥅ related node [[5d chess with multiverse time travel]]

⥅ related node [[5d chess]]

⥅ related node [[5e2a6ef598674fc290965a8f0594f28e]]

⥅ related node [[62 modelo para armar]]

⥅ related node [[67]]

⥅ related node [[6c07883062a543e781969363024fcbe0]]

⥅ related node [[6c7226d48c12488ba5c76aed229bbb06]]

⥅ related node [[7 10]]

⥅ related node [[79]]

⥅ related node [[8 pomodoros]]

⥅ related node [[80 time]]

⥅ related node [[87c6d7d3abdc4b579504de95ca1abf20]]

⥅ related node [[8bitdo retro keyboard]]

⥅ related node [[8bitdo]]

⥅ related node [[913f1007cb7e4eefa826aa95497073df]]

⥅ related node [[97]]

⥅ related node [[_f0_9f_a6_b0]]

⥅ related node [[a bicycle for our minds]]

⥅ related node [[a cheatsheet on discourse]]

⥅ related node [[a conversation about annotation literacy and learning]]

⥅ related node [[a cyborg manifesto]]

⥅ related node [[a declaration of the independence of cyberspace]]

⥅ related node [[a fika monster]]

⥅ related node [[a flash of lightning in the dark of night]]

⥅ related node [[a fortiori]]

⥅ related node [[a glastonbury romance]]

⥅ related node [[a guide to the bodhisattva s way of life]]

⥅ related node [[a manager you can trust]]

⥅ related node [[a naive plan for a freer internet]]

⥅ related node [[a neither]]

⥅ related node [[a new kind of science]]

⥅ related node [[a note taking problem and a proposed solution]]

⥅ related node [[a pattern language]]

⥅ related node [[a perfect vacuum]]

⥅ related node [[a rosetta stone]]

⥅ related node [[a typo]]

⥅ related node [[a view of the agora at a node is a comonad]]

⥅ related node [[a yawning cat]]

⥅ related node [[a p ]]

⥅ related node [[a18d2a1d780749b98fa2e3b93a7de767]]

⥅ related node [[aaaaarg]]

⥅ related node [[aarne thompson uther]]

⥅ related node [[aaron swartz]]

⥅ related node [[abdullah öcalan]]

⥅ related node [[abelard]]

⥅ related node [[ablueaeshna]]

⥅ related node [[abolition of the state]]

⥅ related node [[aborto legal]]

⥅ related node [[about children]]

⥅ related node [[absolute]]

⥅ related node [[abstract fairy]]

⥅ related node [[abstractfairy]]

⥅ related node [[abuelo]]

⥅ related node [[aby warburg]]

⥅ related node [[academic urban legends]]

⥅ related node [[aceite de coco]]

⥅ related node [[acesounderglass]]

⥅ related node [[acid banger]]

⥅ related node [[ack]]

⥅ related node [[acquiescence]]

⥅ related node [[act well]]

⥅ related node [[action code]]

⥅ related node [[action]]

⥅ related node [[active recall]]

⥅ related node [[activist]]

⥅ related node [[activity pub]]

⥅ related node [[activitypub]]

⥅ related node [[acts of flancia]]

⥅ related node [[adam fitchett]]

⥅ related node [[adam wiggins]]

⥅ related node [[add service]]

⥅ related node [[add]]

⥅ related node [[add0n]]

⥅ related node [[addheader py]]

⥅ related node [[addiction]]

⥅ related node [[adding a new search engine in chromium]]

⥅ related node [[adding a search engine]]

⥅ related node [[adduser]]

⥅ related node [[adenosine triphosphate]]

⥅ related node [[adhd]]

⥅ related node [[adriene mishler]]

⥅ related node [[adulto a cargo]]

⥅ related node [[adventure game engines]]

⥅ related node [[adversarial interoperability]]

⥅ related node [[advisory opinion]]

⥅ related node [[adzenys]]

⥅ related node [[adán buenosayres]]

⥅ related node [[aether]]

⥅ related node [[aethereans]]

⥅ related node [[aeyokay]]

⥅ related node [[afiches]]

⥅ related node [[africa design travel]]

⥅ related node [[ag]]

⥅ related node [[age of em]]

⥅ related node [[agile]]

⥅ related node [[agnes cameron]]

⥅ related node [[agnès varda]]

⥅ related node [[agor chat]]

⥅ related node [[agor]]

⥅ related node [[agora 0 5 1]]

⥅ related node [[agora 2022]]

⥅ related node [[agora 3]]

⥅ related node [[agora abstract]]

⥅ related node [[agora action]]

⥅ related node [[agora actions]]

⥅ related node [[agora activitypub integration]]

⥅ related node [[agora algorithm]]

⥅ related node [[agora api]]

⥅ related node [[agora apis]]

⥅ related node [[agora architecture]]

⥅ related node [[agora bootstrap]]

⥅ related node [[agora bot bugs]]

⥅ related node [[agora bot matrix]]

⥅ related node [[agora bot]]

⥅ related node [[agora bridge api]]

⥅ related node [[agora bridge js]]

⥅ related node [[agora bridge]]

⥅ related node [[agora channels]]

⥅ related node [[agora chapter 2]]

⥅ related node [[agora chapter 2023]]

⥅ related node [[agora chapter appendix]]

⥅ related node [[agora chapter final]]

⥅ related node [[agora chapter unlinked]]

⥅ related node [[agora chapter]]

⥅ related node [[agora chat]]

⥅ related node [[agora chrome]]

⥅ related node [[agora cli]]

⥅ related node [[agora client]]

⥅ related node [[agora clients]]

⥅ related node [[agora code]]

⥅ related node [[agora comments]]

⥅ related node [[agora commons]]

⥅ related node [[agora contexts]]

⥅ related node [[agora contract]]

⥅ related node [[agora convention]]

⥅ related node [[agora copyright]]

⥅ related node [[agora ctzn]]

⥅ related node [[agora dashboard]]

⥅ related node [[agora demo]]

⥅ related node [[agora design]]

⥅ related node [[agora development]]

⥅ related node [[agora diagram]]

⥅ related node [[agora diagrams]]

⥅ related node [[agora discord]]

⥅ related node [[agora discus]]

⥅ related node [[agora discuss]]

⥅ related node [[agora doc]]

⥅ related node [[agora docs import]]

⥅ related node [[agora editor]]

⥅ related node [[agora editors]]

⥅ related node [[agora elinor ostrom]]

⥅ related node [[agora embed]]

⥅ related node [[agora es]]

⥅ related node [[agora exchange format]]

⥅ related node [[agora ext]]

⥅ related node [[agora faqs]]

⥅ related node [[agora feature requests]]

⥅ related node [[agora fediverse integration]]

⥅ related node [[agora feeds]]

⥅ related node [[agora for ea]]

⥅ related node [[agora forum]]

⥅ related node [[agora fuzzy matching]]

⥅ related node [[agora fw]]

⥅ related node [[agora go links integration]]

⥅ related node [[agora graph]]

⥅ related node [[agora graphs]]

⥅ related node [[agora help]]

⥅ related node [[agora hn]]

⥅ related node [[agora howto]]

⥅ related node [[agora hub]]

⥅ related node [[agora hypothesis integration]]

⥅ related node [[agora hypothesis]]

⥅ related node [[agora install]]

⥅ related node [[agora instances]]

⥅ related node [[agora integration]]

⥅ related node [[agora js]]

⥅ related node [[agora like]]

⥅ related node [[agora likes]]

⥅ related node [[agora links]]

⥅ related node [[agora mastodon bot]]

⥅ related node [[agora mastodon integration]]

⥅ related node [[agora matrix bot]]

⥅ related node [[agora mediawiki integration]]

⥅ related node [[agora meet]]

⥅ related node [[agora music]]

⥅ related node [[agora nodes]]

⥅ related node [[agora of flancia]]

⥅ related node [[agora open questions]]

⥅ related node [[agora osm]]

⥅ related node [[agora outage]]

⥅ related node [[agora paper]]

⥅ related node [[agora participation]]

⥅ related node [[agora pkg book chapter]]

⥅ related node [[agora pkg book]]

⥅ related node [[agora pkg chapter]]

⥅ related node [[agora pkm chapter]]

⥅ related node [[agora pkmchat]]

⥅ related node [[agora plan]]

⥅ related node [[agora playlist edit]]

⥅ related node [[agora playlist]]

⥅ related node [[agora polls]]

⥅ related node [[agora project]]

⥅ related node [[agora promnesia]]

⥅ related node [[agora protocol]]

⥅ related node [[agora prs]]

⥅ related node [[agora publishing]]

⥅ related node [[agora push]]

⥅ related node [[agora ranking]]

⥅ related node [[agora reader]]

⥅ related node [[agora reading club]]

⥅ related node [[agora recipe]]

⥅ related node [[agora recipes]]

⥅ related node [[agora resources]]

⥅ related node [[agora rfc]]

⥅ related node [[agora rfcs]]

⥅ related node [[agora roadmap 2020]]

⥅ related node [[agora seach]]

⥅ related node [[agora search]]

⥅ related node [[agora server]]

⥅ related node [[agora service]]

⥅ related node [[agora settings]]

⥅ related node [[agora setup]]

⥅ related node [[agora shaped]]

⥅ related node [[agora signup]]

⥅ related node [[agora slides 2023]]

⥅ related node [[agora slides]]

⥅ related node [[agora social bridge]]

⥅ related node [[agora social media integration]]

⥅ related node [[agora space]]

⥅ related node [[agora speed]]

⥅ related node [[agora sync]]

⥅ related node [[agora talk 2021 06 04]]

⥅ related node [[agora talk]]

⥅ related node [[agora talks]]

⥅ related node [[agora tree example]]

⥅ related node [[agora trees]]

⥅ related node [[agora twitter bug]]

⥅ related node [[agora twitter integration]]

⥅ related node [[agora ui]]

⥅ related node [[agora v0 5]]

⥅ related node [[agora v1]]

⥅ related node [[agora version]]

⥅ related node [[agora versioning]]

⥅ related node [[agora vscode]]

⥅ related node [[agora walkthrough]]

⥅ related node [[agora wiki]]

⥅ related node [[agora yaml]]

⥅ related node [[agora youtube integration]]

⥅ related node [[agora4g]]

⥅ related node [[agorabot]]

⥅ related node [[agorai]]

⥅ related node [[agorans]]

⥅ related node [[agoras of the future]]

⥅ related node [[agoras of the past]]

⥅ related node [[agoras]]

⥅ related node [[agoreans]]

⥅ related node [[agorism]]

⥅ related node [[agua para los sedientos]]

⥅ related node [[agua]]

⥅ related node [[aharonov bohm effect]]

⥅ related node [[ahs]]

⥅ related node [[ai dungeon]]

⥅ related node [[ai governance]]

⥅ related node [[aim]]

⥅ related node [[airing of grievances]]

⥅ related node [[airto moreira]]

⥅ related node [[aix en provence]]

⥅ related node [[aka]]

⥅ related node [[akkoma]]

⥅ related node [[akshay]]

⥅ related node [[akshobhya]]

⥅ related node [[alan laidlaw]]

⥅ related node [[alan perlis]]

⥅ related node [[alan watts]]

⥅ related node [[alarming breath]]

⥅ related node [[albert laszlo barabasi]]

⥅ related node [[albin zollinger]]

⥅ related node [[albricias]]

⥅ related node [[aldhari]]

⥅ related node [[aleksandr kuprín]]

⥅ related node [[aleph zero]]

⥅ related node [[alex schroeder]]

⥅ related node [[alexander berkman]]

⥅ related node [[alexander huber]]

⥅ related node [[alexander rink]]

⥅ related node [[alexander sokurov]]

⥅ related node [[alexander]]

⥅ related node [[alfred russel wallace]]

⥅ related node [[algernon argument]]

⥅ related node [[algorithm]]

⥅ related node [[algún día]]

⥅ related node [[ali abdaal]]

⥅ related node [[alice albrecht]]

⥅ related node [[alice chikara]]

⥅ related node [[alice]]

⥅ related node [[alive]]

⥅ related node [[all about circuits]]

⥅ related node [[all beings]]

⥅ related node [[all conscious beings]]

⥅ related node [[all day]]

⥅ related node [[all musicians are connected]]

⥅ related node [[all night]]

⥅ related node [[all nodes]]

⥅ related node [[all possible wikilinks]]

⥅ related node [[all praise the jewel in the lotus]]

⥅ related node [[all sentient beings]]

⥅ related node [[all together now]]

⥅ related node [[all tomorrow s parties]]

⥅ related node [[all tomorrows parties]]

⥅ related node [[all watched over by machines of loving grace]]

⥅ related node [[alle bolo bolo oder was?]]

⥅ related node [[allegory of the cave]]

⥅ related node [[allergic reaction]]

⥅ related node [[almanac]]

⥅ related node [[almost friday]]

⥅ related node [[alphaevolve]]

⥅ related node [[alternative left entertainment]]

⥅ related node [[alternatives]]

⥅ related node [[altersapukai]]

⥅ related node [[altruism]]

⥅ related node [[altruist]]

⥅ related node [[alvin zollinger]]

⥅ related node [[ama]]

⥅ related node [[amadeo]]

⥅ related node [[amateur utopian]]

⥅ related node [[amigos]]

⥅ related node [[amir]]

⥅ related node [[amish]]

⥅ related node [[amit dutta]]

⥅ related node [[amnesia haze]]

⥅ related node [[amores hallarás]]

⥅ related node [[ampl]]

⥅ related node [[amsomniac]]

⥅ related node [[amélia]]

⥅ related node [[américa latina en movimiento]]

⥅ related node [[an agora is what google could be]]

⥅ related node [[an agora]]

⥅ related node [[an analog guy in a digital world]]

⥅ related node [[an analysis of the role of invariant patterns]]

⥅ related node [[an invitation to applied category theory]]

⥅ related node [[an ode to the fight against moloch]]

⥅ related node [[an open letter to an agora]]

⥅ related node [[an open letter to an open nation]]

⥅ related node [[an open letter to an open society]]

⥅ related node [[an open letter to the agora]]

⥅ related node [[an open letter to x]]

⥅ related node [[an utopian]]

⥅ related node [[an]]

⥅ related node [[ana roxanne]]

⥅ related node [[ana stone]]

⥅ related node [[ana ulin]]

⥅ related node [[ana]]

⥅ related node [[anagora api]]

⥅ related node [[ananda]]

⥅ related node [[anar chi st]]

⥅ related node [[anarchism]]

⥅ related node [[anarchist cybernetics]]

⥅ related node [[anarchist library]]

⥅ related node [[anarchist]]

⥅ related node [[anarcho anarcho capitalist]]

⥅ related node [[anarcho capitalism]]

⥅ related node [[anarcho communism]]

⥅ related node [[anarcho syncretism]]

⥅ related node [[anarchy in action]]

⥅ related node [[anatapindika]]

⥅ related node [[anathapindika]]

⥅ related node [[anchors]]

⥅ related node [[ancla]]

⥅ related node [[anderbill]]

⥅ related node [[andi nachon]]

⥅ related node [[andreas kaufmann]]

⥅ related node [[andrei ciortea]]

⥅ related node [[andres gomez emilson]]

⥅ related node [[andrew burton]]

⥅ related node [[andrew marantz]]

⥅ related node [[andrew yang]]

⥅ related node [[andy matuschak]]

⥅ related node [[angelus]]

⥅ related node [[anger and patience]]

⥅ related node [[anil seth]]

⥅ related node [[animal]]

⥅ related node [[anirudh badri]]

⥅ related node [[anisina]]

⥅ related node [[anita]]

⥅ related node [[anna gat]]

⥅ related node [[anna raverat]]

⥅ related node [[anne claire]]

⥅ related node [[anne laure le cunff]]

⥅ related node [[annotated bookmarks]]

⥅ related node [[annotated hub of science]]

⥅ related node [[annotation and the social prize of educational dignity]]

⥅ related node [[annotation standard]]

⥅ related node [[annotation]]

⥅ related node [[announcements]]

⥅ related node [[annus mirabilis]]

⥅ related node [[anonymous]]

⥅ related node [[another social network is possible]]

⥅ related node [[another try]]

⥅ related node [[another]]

⥅ related node [[ansible quickstart]]

⥅ related node [[answer]]

⥅ related node [[antakshari]]

⥅ related node [[antar]]

⥅ related node [[anthilemoon]]

⥅ related node [[anthropocentrism]]

⥅ related node [[anti civ]]

⥅ related node [[anti disintermediation]]

⥅ related node [[anti fascist]]

⥅ related node [[anti libraries]]

⥅ related node [[anti agora]]

⥅ related node [[antiagora]]

⥅ related node [[antiagoras]]

⥅ related node [[antiflancia]]

⥅ related node [[antisocial]]

⥅ related node [[antithesis]]

⥅ related node [[anu]]

⥅ related node [[any agora]]

⥅ related node [[anything]]

⥅ related node [[ap]]

⥅ related node [[apache marmotta]]

⥅ related node [[apache]]

⥅ related node [[api42]]

⥅ related node [[apl]]

⥅ related node [[apology]]

⥅ related node [[append only]]

⥅ related node [[append]]

⥅ related node [[applying mindfulness]]

⥅ related node [[approval required]]

⥅ related node [[apps script unlink]]

⥅ related node [[apps script]]

⥅ related node [[aprender de grandes]]

⥅ related node [[aquila network]]

⥅ related node [[arabian nights]]

⥅ related node [[aragon]]

⥅ related node [[arahant]]

⥅ related node [[arahants]]

⥅ related node [[aral]]

⥅ related node [[arbitrary pulls]]

⥅ related node [[arcades project]]

⥅ related node [[arcades]]

⥅ related node [[architectonyx]]

⥅ related node [[architectural pattern]]

⥅ related node [[architecture]]

⥅ related node [[arcologies]]

⥅ related node [[arcology]]

⥅ related node [[arcosanti]]

⥅ related node [[arena]]

⥅ related node [[argdown]]

⥅ related node [[argentina has some vaporwave powerhouses]]

⥅ related node [[argentinian independence day]]

⥅ related node [[argh]]

⥅ related node [[arghzero]]

⥅ related node [[arguments against open source]]

⥅ related node [[arhat]]

⥅ related node [[armengol altayo]]

⥅ related node [[armengol flancian]]

⥅ related node [[armengol lorand]]

⥅ related node [[armengol]]

⥅ related node [[armengolaltayo]]

⥅ related node [[army of love]]

⥅ related node [[arnold schrijver]]

⥅ related node [[arrow]]

⥅ related node [[arrows]]

⥅ related node [[art 61]]

⥅ related node [[art 68]]

⥅ related node [[art blakey]]

⥅ related node [[arte problemático]]

⥅ related node [[arth goldau]]

⥅ related node [[arthashastra]]

⥅ related node [[arthur koestler]]

⥅ related node [[arti walker peddakotla]]

⥅ related node [[artist or ai]]

⥅ related node [[as we fork we ll merge]]

⥅ related node [[as we get to know each other]]

⥅ related node [[as we merge we ll fork]]

⥅ related node [[as]]

⥅ related node [[asa pili]]

⥅ related node [[asabiyyah]]

⥅ related node [[asado verbal]]

⥅ related node [[asana]]

⥅ related node [[asanas]]

⥅ related node [[asignaciones]]

⥅ related node [[ask]]

⥅ related node [[2021 01 26 21 20 48]]

⥅ related node [[2021 01 26 21 51 31]]

⥅ related node [[2021 04 14 13 11 35]]

⥅ related node [[2022 01 19 17 00 58]]

⥅ related node [[2022 05 15 155718_5280x3240_scrot]]

⥅ related node [[decentralized]]

⥅ related node [[flammarion engraving]]

⥅ related node [[flan]]

⥅ related node [[flanciaflag xaos]]

⥅ related node [[flaneur]]

⥅ related node [[fractal flancia]]

⥅ related node [[ibuku]]

⥅ related node [[image_1643555480528_0]]

⥅ related node [[image_1644599439384_0]]

⥅ related node [[image_1644693894014_0]]

⥅ related node [[image_1645038847124_0]]

⥅ related node [[image_1647788528070_0]]

⥅ related node [[image_1651934011588_0]]

⥅ related node [[image_1651936625981_0]]

⥅ related node [[image_1651937923418_0]]

⥅ related node [[image_1651938029677_0]]

⥅ related node [[image_1651941677533_0]]

⥅ related node [[image_1652018672178_0]]

⥅ related node [[image_1652294696554_0]]

⥅ related node [[image_1652303360260_0]]

⥅ related node [[image_1652472452922_0]]

⥅ related node [[image_1652472463733_0]]

⥅ related node [[image_1652472533861_0]]

⥅ related node [[image_1652569093865_0]]

⥅ related node [[image_1652569110981_0]]

⥅ related node [[image_1652980660170_0]]

⥅ related node [[image_1653173270579_0]]

⥅ related node [[image_1653227629683_0]]

⥅ related node [[image_2022 05 26 16 05 58]]

⥅ related node [[kitler]]

⥅ related node [[la chaux de fonds]]

⥅ related node [[labyrinth]]

⥅ related node [[launchlet]]

⥅ related node [[mandelbrot^5]]

⥅ related node [[mort garson]]

⥅ related node [[mr random]]

⥅ related node [[musgum huts]]

⥅ related node [[nestor makhno]]

⥅ related node [[ocell2]]

⥅ related node [[pinafore]]

⥅ related node [[proper subset]]

⥅ related node [[sandokan]]

⥅ related node [[schelling]]

⥅ related node [[the book of the new sun]]

⥅ related node [[the software shall be used for good not evil]]

⥅ related node [[toot]]

⥅ related node [[tree shaping]]

⥅ related node [[tree]]

⥅ related node [[underlay]]

⥅ related node [[assistant]]

⥅ related node [[astadala yogamala]]

⥅ related node [[astor piazzolla]]

⥅ related node [[asus zenbook resumes and then immediately suspends]]

⥅ related node [[async art]]

⥅ related node [[async chat]]

⥅ related node [[async search]]

⥅ related node [[así murió mi papá]]

⥅ related node [[at json agora]]

⥅ related node [[at mention followers]]

⥅ related node [[at the dam]]

⥅ related node [[athens export]]

⥅ related node [[athens research]]

⥅ related node [[atjson]]

⥅ related node [[atom]]

⥅ related node [[atoma]]

⥅ related node [[atomic search]]

⥅ related node [[atproto]]

⥅ related node [[atrasados 1000 años]]

⥅ related node [[attachments]]

⥅ related node [[attack on titan]]

⥅ related node [[audiences]]

⥅ related node [[audio recorder]]

⥅ related node [[augment minds 2021]]

⥅ related node [[augment minds]]

⥅ related node [[augmenting human intellect]]

⥅ related node [[august 2021]]

⥅ related node [[augustus pablo]]

⥅ related node [[author]]

⥅ related node [[auto commit messages]]

⥅ related node [[auto pull plurals]]

⥅ related node [[auto push]]

⥅ related node [[auto wikilinking]]

⥅ related node [[auto wp]]

⥅ related node [[autofs]]

⥅ related node [[automation]]

⥅ related node [[autopull]]

⥅ related node [[autopush]]

⥅ related node [[autopush sh]]

⥅ related node [[avalokitasvara]]

⥅ related node [[avalokiteshjara]]

⥅ related node [[avalokiteshvara somos nosotros]]

⥅ related node [[avalokiteshvara]]

⥅ related node [[avalokitesvara]]

⥅ related node [[avatamsaka sutra]]

⥅ related node [[aventine keyhole]]

⥅ related node [[avery]]

⥅ related node [[avi weiss]]

⥅ related node [[avianca 11]]

⥅ related node [[avif]]

⥅ related node [[awake]]

⥅ related node [[awaken]]

⥅ related node [[awakened]]

⥅ related node [[awakening]]

⥅ related node [[awesome foundation]]

⥅ related node [[awesome wiki projects]]

⥅ related node [[axelrod s tournament]]

⥅ related node [[ayn rand]]

⥅ related node [[azlen elza]]

⥅ related node [[b a]]

⥅ related node [[b enterprises]]

⥅ related node [[b f skinner]]

⥅ related node [[b ]]

⥅ related node [[baby]]

⥅ related node [[bach]]

⥅ related node [[back link]]

⥅ related node [[back problems]]

⥅ related node [[backlink]]

⥅ related node [[backnoded]]

⥅ related node [[backnoding]]

⥅ related node [[backups]]

⥅ related node [[backus naur form]]

⥅ related node [[bag of holding]]

⥅ related node [[bags of holding]]

⥅ related node [[bairn ashtrit]]

⥅ related node [[balafon sketches]]

⥅ related node [[balaji srinivasan]]

⥅ related node [[balajis]]

⥅ related node [[balcony]]

⥅ related node [[bali]]

⥅ related node [[bamboo garden]]

⥅ related node [[bang for the buck]]

⥅ related node [[banger]]

⥅ related node [[bangers]]

⥅ related node [[bangle]]

⥅ related node [[bankline]]

⥅ related node [[bar]]

⥅ related node [[barbedcatpenis]]

⥅ related node [[barbieri]]

⥅ related node [[bard]]

⥅ related node [[bardia]]

⥅ related node [[bardo]]

⥅ related node [[bargalló]]

⥅ related node [[barranco]]

⥅ related node [[bart kosko]]

⥅ related node [[based]]

⥅ related node [[basic income]]

⥅ related node [[bassel khartabil]]

⥅ related node [[battle of dyrrhachium]]

⥅ related node [[battle of pharsalus]]

⥅ related node [[baz]]

⥅ related node [[bcrypt]]

⥅ related node [[be]]

⥅ related node [[beagle]]

⥅ related node [[beaker browser]]

⥅ related node [[bean bank]]

⥅ related node [[bearer of good news]]

⥅ related node [[bearer token]]

⥅ related node [[beau haan]]

⥅ related node [[beautiful mycorrhiza]]

⥅ related node [[beautiful]]

⥅ related node [[become dorcas]]

⥅ related node [[become nostromo]]

⥅ related node [[become paramita]]

⥅ related node [[become]]

⥅ related node [[beefsteak]]

⥅ related node [[beepb00p]]

⥅ related node [[beeper]]

⥅ related node [[beethoven]]

⥅ related node [[before and after cache]]

⥅ related node [[beginning of infinity]]

⥅ related node [[being offline]]

⥅ related node [[being open]]

⥅ related node [[being]]

⥅ related node [[bell evans]]

⥅ related node [[bella burup]]

⥅ related node [[ben chase]]

⥅ related node [[ben congdon]]

⥅ related node [[ben shapiro]]

⥅ related node [[bendini fettuccini]]

⥅ related node [[benedict lau]]

⥅ related node [[benedictine monastery]]

⥅ related node [[benedictine rule]]

⥅ related node [[benefolent director for life]]

⥅ related node [[benevolent dictator for life]]

⥅ related node [[benevolent director for life]]

⥅ related node [[benford s law]]

⥅ related node [[bengo]]

⥅ related node [[benito]]

⥅ related node [[benjamin franklin]]

⥅ related node [[berkeley anarchist group]]

⥅ related node [[bernard stiegler]]

⥅ related node [[best japanese movies]]

⥅ related node [[best sci fi movies]]

⥅ related node [[best sites on the internet]]

⥅ related node [[bestiario]]

⥅ related node [[better ranking]]

⥅ related node [[better than a tree]]

⥅ related node [[betters]]

⥅ related node [[betula]]

⥅ related node [[between walls]]

⥅ related node [[beyond cprofile]]

⥅ related node [[beyond knowledge graphs]]

⥅ related node [[beyond markdown and git]]

⥅ related node [[bhaugen]]

⥅ related node [[bhi backups]]

⥅ related node [[bibliographical]]

⥅ related node [[bibliotheque mejanes]]

⥅ related node [[big blue button]]

⥅ related node [[big in japan]]

⥅ related node [[big list of naughty strings]]

⥅ related node [[big movie list]]

⥅ related node [[big self]]

⥅ related node [[big timer]]

⥅ related node [[bigger in the inside]]

⥅ related node [[bill anderson]]

⥅ related node [[bill evans]]

⥅ related node [[bill frisell]]

⥅ related node [[bill seitz]]

⥅ related node [[bin repo]]

⥅ related node [[binding chaos]]

⥅ related node [[bingke]]

⥅ related node [[biocentrism]]

⥅ related node [[bip39]]

⥅ related node [[bird feeder]]

⥅ related node [[birdbear]]

⥅ related node [[birthdays]]

⥅ related node [[bisse]]

⥅ related node [[bisses]]

⥅ related node [[bitcoinvault]]

⥅ related node [[bitlbee]]

⥅ related node [[bitwascherei]]

⥅ related node [[bitwäscherei]]

⥅ related node [[black kallax]]

⥅ related node [[blackbox exporter]]

⥅ related node [[blaine]]

⥅ related node [[bldgblog]]

⥅ related node [[blessed bits]]

⥅ related node [[blessed]]

⥅ related node [[blessing]]

⥅ related node [[blessings]]

⥅ related node [[blob opera]]

⥅ related node [[blobs]]

⥅ related node [[block references]]

⥅ related node [[blockchain chicken farm]]

⥅ related node [[blockchains]]

⥅ related node [[blocklist]]

⥅ related node [[blue dream]]

⥅ related node [[blue lp]]

⥅ related node [[blue oak]]

⥅ related node [[bluesky and enshittification]]

⥅ related node [[bluesky]]

⥅ related node [[bmann]]

⥅ related node [[bmock]]

⥅ related node [[bobby light]]

⥅ related node [[bobby lyte]]

⥅ related node [[bodhi svaha]]

⥅ related node [[bodhicitta]]

⥅ related node [[bodhisattva vow]]

⥅ related node [[bodhisattva]]

⥅ related node [[bodhisattvas]]

⥅ related node [[bodyspace]]

⥅ related node [[bolo bolo]]

⥅ related node [[bolo]]

⥅ related node [[bolos]]

⥅ related node [[bonfire]]

⥅ related node [[book club]]

⥅ related node [[book of the new sun]]

⥅ related node [[book]]

⥅ related node [[books]]

⥅ related node [[boos did 911]]

⥅ related node [[bootstrap]]

⥅ related node [[borges por piglia]]

⥅ related node [[borges]]

⥅ related node [[boris mann]]

⥅ related node [[both]]

⥅ related node [[bots]]

⥅ related node [[botsin space]]

⥅ related node [[bouncepaw]]

⥅ related node [[bqn]]

⥅ related node [[brah]]

⥅ related node [[braid]]

⥅ related node [[braided]]

⥅ related node [[braids]]

⥅ related node [[branches]]

⥅ related node [[branching chess]]

⥅ related node [[brandenburg concertos]]

⥅ related node [[brandon toner]]

⥅ related node [[brasilia]]

⥅ related node [[brassica oleracea]]

⥅ related node [[break glass]]

⥅ related node [[breath is the palace of buddha]]

⥅ related node [[breath is the palace of the buddha]]

⥅ related node [[breath of desire]]

⥅ related node [[breath]]

⥅ related node [[breathe]]

⥅ related node [[breathing]]

⥅ related node [[breck yunits]]

⥅ related node [[brennenstuhl]]

⥅ related node [[bret weinstein]]

⥅ related node [[brettkromkamp]]

⥅ related node [[brian eno]]

⥅ related node [[brian kernighan]]

⥅ related node [[brian mock]]

⥅ related node [[brian moriarty]]

⥅ related node [[brian sunter]]

⥅ related node [[bricolage]]

⥅ related node [[bridge]]

⥅ related node [[bridges]]

⥅ related node [[bright mind]]

⥅ related node [[broadcast]]

⥅ related node [[brontë sisters]]

⥅ related node [[brook farm]]

⥅ related node [[brooke]]

⥅ related node [[brother mfc l2710dw]]

⥅ related node [[brown noise]]

⥅ related node [[brownian motion]]

⥅ related node [[browser extension]]

⥅ related node [[browser extensions]]

⥅ related node [[browser parrot]]

⥅ related node [[browser]]

⥅ related node [[browsers]]

⥅ related node [[bruno winck]]

⥅ related node [[brutaldon]]

⥅ related node [[bryce huebner]]

⥅ related node [[buchbinderei]]

⥅ related node [[buda]]

⥅ related node [[buddha]]

⥅ related node [[buddhas]]

⥅ related node [[buddhism]]

⥅ related node [[buddhist geeks]]

⥅ related node [[buddhist orange]]

⥅ related node [[buddhist]]

⥅ related node [[budget]]

⥅ related node [[buenos aires]]

⥅ related node [[bug tracker]]

⥅ related node [[bugs]]

⥅ related node [[build bridges]]

⥅ related node [[build maitreya]]

⥅ related node [[build pyramids]]

⥅ related node [[building an agora]]

⥅ related node [[building annotation into browsers]]

⥅ related node [[building augmented knowledge architectures]]

⥅ related node [[building autmented knowledge architectures]]

⥅ related node [[building bridges]]

⥅ related node [[bukowski]]

⥅ related node [[bull]]

⥅ related node [[bullafulminante]]

⥅ related node [[burma shave]]

⥅ related node [[burn brightly]]

⥅ related node [[burn burn burn]]

⥅ related node [[burn for good]]

⥅ related node [[burn for greater good]]

⥅ related node [[burn for the greater good]]

⥅ related node [[burn kindly]]

⥅ related node [[burn moloch]]

⥅ related node [[burn]]

⥅ related node [[burning bridges]]

⥅ related node [[burning chrome]]

⥅ related node [[burning chromium]]

⥅ related node [[burning]]

⥅ related node [[burup de ojos verdes]]

⥅ related node [[burup forever]]

⥅ related node [[burup maitreyas]]

⥅ related node [[burup peninsula]]

⥅ related node [[burup]]

⥅ related node [[buscarle profesor de inglés online a mamá]]

⥅ related node [[busy cafe]]

⥅ related node [[busy texas cafe]]

⥅ related node [[buy]]

⥅ related node [[by default]]

⥅ related node [[c k ogden]]

⥅ related node [[c2]]

⥅ related node [[c5n]]

⥅ related node [[cabal]]

⥅ related node [[cabet]]

⥅ related node [[cabridge heretics]]

⥅ related node [[cacodelphia]]

⥅ related node [[cacophony society]]

⥅ related node [[cacotopoi]]

⥅ related node [[café tacvba]]

⥅ related node [[caiac]]

⥅ related node [[cake]]

⥅ related node [[cal]]

⥅ related node [[calendario]]

⥅ related node [[calendly]]

⥅ related node [[calendso]]

⥅ related node [[calico fisk]]

⥅ related node [[california dreaming]]

⥅ related node [[cambridge heretics]]

⥅ related node [[cameras and lenses]]

⥅ related node [[can t break your heart]]

⥅ related node [[can t get you out of my head]]

⥅ related node [[canción sin miedo]]

⥅ related node [[candid]]

⥅ related node [[candidly]]

⥅ related node [[candles]]

⥅ related node [[canna trade]]

⥅ related node [[cannabis in buddhism]]

⥅ related node [[cannabis]]

⥅ related node [[cannon]]

⥅ related node [[canonical debate lab]]

⥅ related node [[canonical hours]]

⥅ related node [[canonizer]]

⥅ related node [[cant break your heart]]

⥅ related node [[cant get you out of my head]]

⥅ related node [[cantor function]]

⥅ related node [[cap set]]

⥅ related node [[capitalism]]

⥅ related node [[capra course closing circle]]

⥅ related node [[capra course]]

⥅ related node [[capsule wardrobe]]

⥅ related node [[car analogies]]

⥅ related node [[caramel city]]

⥅ related node [[caramel]]

⥅ related node [[caramelldansen]]

⥅ related node [[carbon capture]]

⥅ related node [[carcaj]]

⥅ related node [[cardigan bay]]

⥅ related node [[care home that looks like a town]]

⥅ related node [[carelogic]]

⥅ related node [[carl gieringer]]

⥅ related node [[carl]]

⥅ related node [[carlo ginzburg]]

⥅ related node [[carnival]]

⥅ related node [[carolainfg]]

⥅ related node [[caron]]

⥅ related node [[carrot cake]]

⥅ related node [[carta abierta a milei]]

⥅ related node [[cartas abiertas]]

⥅ related node [[cartola]]

⥅ related node [[casa común]]

⥅ related node [[casio fw 91]]

⥅ related node [[casio]]

⥅ related node [[cat heroin]]

⥅ related node [[cat roulette]]

⥅ related node [[cat tournament]]

⥅ related node [[cat vibing]]

⥅ related node [[cat]]

⥅ related node [[catalog of missing devices]]

⥅ related node [[catalog]]

⥅ related node [[categories]]

⥅ related node [[category theory basics]]

⥅ related node [[category theory for engineers]]

⥅ related node [[category theory for programmers]]

⥅ related node [[category theory]]

⥅ related node [[category]]

⥅ related node [[caterina barbieri]]

⥅ related node [[caternet]]

⥅ related node [[catroulette]]

⥅ related node [[cats]]

⥅ related node [[cavities]]

⥅ related node [[ccr]]

⥅ related node [[cd1c234daaec4472b5d3187651274b62]]

⥅ related node [[cefalea]]

⥅ related node [[celeste summit]]

⥅ related node [[celeste]]

⥅ related node [[celibate monk]]

⥅ related node [[cent]]

⥅ related node [[center for collective learning]]

⥅ related node [[center for land use interpretation]]

⥅ related node [[center]]

⥅ related node [[central mid levels escalator]]

⥅ related node [[ceremony]]

⥅ related node [[challah]]

⥅ related node [[chances]]

⥅ related node [[chandigarth]]

⥅ related node [[chandra easton]]

⥅ related node [[change remote]]

⥅ related node [[change the world without taking power]]

⥅ related node [[change the world]]

⥅ related node [[chaos]]

⥅ related node [[chaotic good rogue]]

⥅ related node [[chapitre]]

⥅ related node [[character class]]

⥅ related node [[character classes]]

⥅ related node [[charismatic shell]]

⥅ related node [[charitably]]

⥅ related node [[charity]]

⥅ related node [[charles bukowski]]

⥅ related node [[charles fourier]]

⥅ related node [[charles murray]]

⥅ related node [[charles stanhop]]

⥅ related node [[charles stanhope]]

⥅ related node [[chartodon]]

⥅ related node [[chartter]]

⥅ related node [[chasing moloch]]

⥅ related node [[chat mode]]

⥅ related node [[chat]]

⥅ related node [[chatgpt playlist]]

⥅ related node [[chatgpt]]

⥅ related node [[chatham house rule]]

⥅ related node [[chatting with glue]]

⥅ related node [[cheap calculator]]

⥅ related node [[cheeses of europe]]

⥅ related node [[chelsea hotel]]

⥅ related node [[chemical freeze]]

⥅ related node [[cheng yen]]

⥅ related node [[chess hypothesis]]

⥅ related node [[chess]]

⥅ related node [[chesterton s fence]]

⥅ related node [[chesterton]]

⥅ related node [[chestertons fence]]

⥅ related node [[chez nous]]

⥅ related node [[chiasm]]

⥅ related node [[chilean transition to democracy]]

⥅ related node [[china a century of revolution]]

⥅ related node [[chip player]]

⥅ related node [[chiptune player]]

⥅ related node [[chocolates]]

⥅ related node [[chogyam trungpa]]

⥅ related node [[chongli qin]]

⥅ related node [[choose the closest]]

⥅ related node [[choose your own adventure]]

⥅ related node [[choosing a mastodon instance]]

⥅ related node [[chophshiy]]

⥅ related node [[chores]]

⥅ related node [[chorus one]]

⥅ related node [[chowdy]]

⥅ related node [[chris aldrich]]

⥅ related node [[chris kervina]]

⥅ related node [[chris moyé]]

⥅ related node [[christian brickhouse]]

⥅ related node [[christianism]]

⥅ related node [[christina bowen]]

⥅ related node [[christof hoch]]

⥅ related node [[christopher alexander reading group]]

⥅ related node [[christopher alexander]]

⥅ related node [[christopher pedregal]]

⥅ related node [[christopher priest]]

⥅ related node [[chrome remote desktop]]

⥅ related node [[chrome]]

⥅ related node [[chronicles of flancia]]

⥅ related node [[chu bu and sheemish]]

⥅ related node [[chungking express]]

⥅ related node [[chungking mansions]]

⥅ related node [[chunking express]]

⥅ related node [[church of earth]]

⥅ related node [[church of the simulation]]

⥅ related node [[church of the singularity]]

⥅ related node [[chögyam trungpa]]

⥅ related node [[cimbalom street musicians]]

⥅ related node [[cimbalom]]

⥅ related node [[cinco años]]

⥅ related node [[circles ubi]]

⥅ related node [[circles world]]

⥅ related node [[circles]]

⥅ related node [[cities]]

⥅ related node [[citizen]]

⥅ related node [[citizense]]

⥅ related node [[city]]

⥅ related node [[cklorentzen]]

⥅ related node [[claire l evans]]

⥅ related node [[clairvoyant]]

⥅ related node [[clarinet fingerings]]

⥅ related node [[clarinet]]

⥅ related node [[claude code]]

⥅ related node [[claude]]

⥅ related node [[clay shirky]]

⥅ related node [[clean the kitchen]]

⥅ related node [[cleo from 5 to 7]]

⥅ related node [[click]]

⥅ related node [[clicker]]

⥅ related node [[client side pulling]]

⥅ related node [[client]]

⥅ related node [[clipboard management]]

⥅ related node [[cliq hop]]

⥅ related node [[cliqhop]]

⥅ related node [[clojure made simple]]

⥅ related node [[clojure]]

⥅ related node [[clojurescript]]

⥅ related node [[closed letters]]

⥅ related node [[closer to truth]]

⥅ related node [[cloud computer]]

⥅ related node [[cloud computers]]

⥅ related node [[cobeing]]

⥅ related node [[coco]]

⥅ related node [[cocodrilo dundee]]

⥅ related node [[coconut oil]]

⥅ related node [[coconut take aways]]

⥅ related node [[code of conduct]]

⥅ related node [[code server]]

⥅ related node [[code]]

⥅ related node [[codemirror]]

⥅ related node [[codex editor]]

⥅ related node [[codex]]

⥅ related node [[codexeditor]]

⥅ related node [[codextopia]]

⥅ related node [[coding projects]]

⥅ related node [[coding]]

⥅ related node [[cofradía del link]]

⥅ related node [[cogconfluence]]

⥅ related node [[cognacore]]

⥅ related node [[cognitive devices]]

⥅ related node [[cognitive load]]

⥅ related node [[colifing]]

⥅ related node [[colin the mathmo]]

⥅ related node [[colin turner]]

⥅ related node [[colin ward]]

⥅ related node [[collect]]

⥅ related node [[collected poetry]]

⥅ related node [[collection of notes]]

⥅ related node [[collective and augmented intelligence against covid]]

⥅ related node [[collective poetry]]

⥅ related node [[collective sense commons]]

⥅ related node [[collective tools]]

⥅ related node [[collective]]

⥅ related node [[colleen]]

⥅ related node [[collimate]]

⥅ related node [[color qr]]

⥅ related node [[colors of noise]]

⥅ related node [[come]]

⥅ related node [[command k]]

⥅ related node [[command line interface]]

⥅ related node [[commander]]

⥅ related node [[comments]]

⥅ related node [[commit template]]

⥅ related node [[common areas at the heart]]

⥅ related node [[commons]]

⥅ related node [[commonspub]]

⥅ related node [[comms]]

⥅ related node [[communes]]

⥅ related node [[communication]]

⥅ related node [[communism]]

⥅ related node [[communities of practice]]

⥅ related node [[communities]]

⥅ related node [[community working group]]

⥅ related node [[community]]

⥅ related node [[comonad]]

⥅ related node [[complainer bot]]

⥅ related node [[complementary cognitive artifact]]

⥅ related node [[complementary cognitive artifacts]]

⥅ related node [[complementary]]

⥅ related node [[complex system]]

⥅ related node [[composer]]

⥅ related node [[composite go links]]

⥅ related node [[composition game]]

⥅ related node [[composition]]

⥅ related node [[compost]]

⥅ related node [[computer lib dream machines]]

⥅ related node [[computer lib]]

⥅ related node [[computer system]]

⥅ related node [[computer]]

⥅ related node [[computers and creativity]]

⥅ related node [[computers]]

⥅ related node [[conaw]]

⥅ related node [[concepts techniques and models of computer programming]]

⥅ related node [[conduit]]

⥅ related node [[confederalism]]

⥅ related node [[confederated]]

⥅ related node [[confederation]]

⥅ related node [[confession]]

⥅ related node [[confessions]]

⥅ related node [[config py]]

⥅ related node [[config]]

⥅ related node [[conflict vs mistake]]

⥅ related node [[confoederatio helvetica flanciana]]

⥅ related node [[connect]]

⥅ related node [[connected buildings]]

⥅ related node [[connor st george]]

⥅ related node [[conquer moloch]]

⥅ related node [[conscious beings]]

⥅ related node [[conscious]]

⥅ related node [[consciousness explained]]

⥅ related node [[conservative]]

⥅ related node [[conspiracy]]

⥅ related node [[contacto en flancia]]

⥅ related node [[content nation]]

⥅ related node [[content security policy]]

⥅ related node [[content]]

⥅ related node [[contents]]

⥅ related node [[context collapse]]

⥅ related node [[context]]

⥅ related node [[contextos]]

⥅ related node [[contexts]]

⥅ related node [[contextualise]]

⥅ related node [[contextualize]]

⥅ related node [[contracts]]

⥅ related node [[contributors]]

⥅ related node [[control]]

⥅ related node [[controversy in philosophy]]

⥅ related node [[convention]]

⥅ related node [[conventions]]

⥅ related node [[convergence]]

⥅ related node [[conversation]]

⥅ related node [[conversations with myself]]

⥅ related node [[convolute]]

⥅ related node [[convolutes]]

⥅ related node [[cookie clicker]]

⥅ related node [[cool retro term]]

⥅ related node [[cool retro terminal]]

⥅ related node [[coop cloud recipe]]

⥅ related node [[coop cloud recipes]]

⥅ related node [[coop cloud]]

⥅ related node [[coop hosting]]

⥅ related node [[coop news]]

⥅ related node [[coop pixar]]

⥅ related node [[coop]]

⥅ related node [[cooperate]]

⥅ related node [[cooperating]]

⥅ related node [[cooperation]]

⥅ related node [[cooperativa de diseño]]

⥅ related node [[cooperative competition]]

⥅ related node [[cooperative problem solving]]

⥅ related node [[cooperative systems]]

⥅ related node [[cooperative]]

⥅ related node [[cooperatives]]

⥅ related node [[coops]]

⥅ related node [[coordination problems]]

⥅ related node [[copilot alternatives]]

⥅ related node [[copying]]

⥅ related node [[copyright rationalization]]

⥅ related node [[core]]

⥅ related node [[coreutils decoded]]

⥅ related node [[cormen]]

⥅ related node [[corny]]

⥅ related node [[coronis]]

⥅ related node [[corp only]]

⥅ related node [[corporation for digital scholarship]]

⥅ related node [[corporations are ethical retards]]

⥅ related node [[corpus]]

⥅ related node [[cortex]]

⥅ related node [[cory doctorow]]

⥅ related node [[cosma]]

⥅ related node [[cosmos network]]

⥅ related node [[could love]]

⥅ related node [[count my blessings]]

⥅ related node [[counter anti disintermediation]]

⥅ related node [[counting game]]

⥅ related node [[counting practice]]

⥅ related node [[covid 19 game]]

⥅ related node [[covid 19]]

⥅ related node [[covid tracker]]

⥅ related node [[cow]]

⥅ related node [[coworking with ap]]

⥅ related node [[coworking]]

⥅ related node [[crab fit]]

⥅ related node [[crack azw]]

⥅ related node [[creamy ricotta pasta with broccoli]]

⥅ related node [[creative commons attribution sharealike 4 0 international]]

⥅ related node [[creative commons]]

⥅ related node [[creatively]]

⥅ related node [[creepypasta]]

⥅ related node [[cringe]]

⥅ related node [[cringes]]

⥅ related node [[criptocomunismo]]

⥅ related node [[cristi]]

⥅ related node [[criticism of effective altruism]]

⥅ related node [[critique of worker coops]]

⥅ related node [[crito]]

⥅ related node [[cronopios]]

⥅ related node [[crossposter]]

⥅ related node [[crowdcast]]

⥅ related node [[crowdlaaers]]

⥅ related node [[crowdsourced chess]]

⥅ related node [[crowdsourced filesystem]]

⥅ related node [[crowdsourced search]]

⥅ related node [[crowdsourced]]

⥅ related node [[crowdsourcing]]

⥅ related node [[crpg addict]]

⥅ related node [[crucial collective object]]

⥅ related node [[crush capitalism]]

⥅ related node [[cryptobuddhism]]

⥅ related node [[cryptopunks]]

⥅ related node [[cryptovoxels]]

⥅ related node [[crystal castles]]

⥅ related node [[cscw]]

⥅ related node [[csiro]]

⥅ related node [[css spinner]]

⥅ related node [[ctietze]]

⥅ related node [[ctzn network]]

⥅ related node [[ctzn]]

⥅ related node [[ctznry]]

⥅ related node [[cuello de burup]]

⥅ related node [[cult]]

⥅ related node [[cultural shift]]

⥅ related node [[cumbia]]

⥅ related node [[curb my bullshit]]

⥅ related node [[curlie]]

⥅ related node [[curtin yarvin]]

⥅ related node [[cutting through spiritual materialism]]

⥅ related node [[cwebber]]

⥅ related node [[cwg]]

⥅ related node [[cybenetic surveillant]]

⥅ related node [[cyberfeminist index]]

⥅ related node [[cyberhippie]]

⥅ related node [[cyberiad]]

⥅ related node [[cybernetic surveillant]]

⥅ related node [[cybernetic toaster]]

⥅ related node [[cybernetician]]

⥅ related node [[cyberrachel]]

⥅ related node [[cybersin]]

⥅ related node [[cyberspace]]

⥅ related node [[cybersyn]]

⥅ related node [[cyborg manifesto]]

⥅ related node [[cztn]]

⥅ related node [[césar hidalgo]]

⥅ related node [[cómo es el mar_]]

⥅ related node [[d annunzio]]

⥅ related node [[d p]]

⥅ related node [[d t suzuki]]

⥅ related node [[d&d roles]]

⥅ related node [[d3]]

⥅ related node [[dabbler]]

⥅ related node [[dag]]

⥅ related node [[dahlem botanical gardens]]

⥅ related node [[dai]]

⥅ related node [[daily meditation]]

⥅ related node [[daily]]

⥅ related node [[dall e]]

⥅ related node [[dallas buyers club]]

⥅ related node [[dallee]]

⥅ related node [[dan brown]]

⥅ related node [[dan harris]]

⥅ related node [[dan squier]]

⥅ related node [[dan whaley]]

⥅ related node [[danger]]

⥅ related node [[daniel armengol altayo]]

⥅ related node [[daniel dennett]]

⥅ related node [[daniel doyon]]

⥅ related node [[daniel graham]]

⥅ related node [[daniel ingram]]

⥅ related node [[daniel m ingram]]

⥅ related node [[daniel schmachtenberger]]

⥅ related node [[daniel slutsky]]

⥅ related node [[danielle baskin]]

⥅ related node [[danielm_graham]]

⥅ related node [[danlistensto]]

⥅ related node [[dansquier]]

⥅ related node [[darius kazemi]]

⥅ related node [[darius]]

⥅ related node [[dark horse duo]]

⥅ related node [[dark mode]]

⥅ related node [[darkhorseduo]]

⥅ related node [[darwin s dangerous idea]]

⥅ related node [[daryl davis]]

⥅ related node [[das gewalttätigste element der gesellschaft ist die unwissenheit]]

⥅ related node [[dashtop]]

⥅ related node [[data runner]]

⥅ related node [[datalabitam]]

⥅ related node [[datalog]]

⥅ related node [[datascript]]

⥅ related node [[datawheel]]

⥅ related node [[datd]]

⥅ related node [[dave mills]]

⥅ related node [[dave winer]]

⥅ related node [[davey morse]]

⥅ related node [[david allen]]

⥅ related node [[david bollier]]

⥅ related node [[david c krakauer]]

⥅ related node [[david c]]

⥅ related node [[david deutsch]]

⥅ related node [[david eagleman]]

⥅ related node [[david gelernter]]

⥅ related node [[david krakauer]]

⥅ related node [[david mynors]]

⥅ related node [[day job]]

⥅ related node [[day]]

⥅ related node [[days of being wild]]

⥅ related node [[dazinism]]

⥅ related node [[dbustac]]

⥅ related node [[dead]]

⥅ related node [[dear reader]]

⥅ related node [[debategraph]]

⥅ related node [[debug registration issues]]

⥅ related node [[deceased]]

⥅ related node [[december 2021]]

⥅ related node [[december 2024 adventure]]

⥅ related node [[december adventure 2023]]

⥅ related node [[december adventure]]

⥅ related node [[december yoga]]

⥅ related node [[decent social]]

⥅ related node [[decentered]]

⥅ related node [[decentralized discourse graph]]

⥅ related node [[decentralized identifier]]

⥅ related node [[decision theory]]

⥅ related node [[deconstructing sensory experience]]

⥅ related node [[deconstructing yourself]]

⥅ related node [[deep space one]]

⥅ related node [[deep]]

⥅ related node [[deepfates]]

⥅ related node [[deepl]]

⥅ related node [[deepseek]]

⥅ related node [[default action]]

⥅ related node [[default actions]]

⥅ related node [[default instance]]

⥅ related node [[default mode network]]

⥅ related node [[default mode]]

⥅ related node [[default yoga]]

⥅ related node [[defaults]]

⥅ related node [[defcon radio]]

⥅ related node [[defcon]]

⥅ related node [[defeat moloch]]

⥅ related node [[defeat]]

⥅ related node [[definitions]]

⥅ related node [[defoam]]

⥅ related node [[dej]]

⥅ related node [[delaunay triangulation]]

⥅ related node [[delegate]]

⥅ related node [[dementia]]

⥅ related node [[democracia líquida]]

⥅ related node [[democractic confederalism]]

⥅ related node [[democracy earth]]

⥅ related node [[democracy]]

⥅ related node [[democratic fedi]]

⥅ related node [[democratic fediverse]]

⥅ related node [[dendron]]

⥅ related node [[dennis gabor]]

⥅ related node [[dennis ritchie]]

⥅ related node [[denny vrandecic]]

⥅ related node [[denny vrandečić]]

⥅ related node [[deno]]

⥅ related node [[deprecate capitalism]]

⥅ related node [[derek kozel]]

⥅ related node [[derrick broze]]

⥅ related node [[design from trust]]

⥅ related node [[design principles for governing the commons]]

⥅ related node [[desire paths]]

⥅ related node [[deta]]

⥅ related node [[deus ex]]

⥅ related node [[deutsch]]

⥅ related node [[dev]]

⥅ related node [[devine lu linvega]]

⥅ related node [[devine]]

⥅ related node [[devops]]

⥅ related node [[dezoomify]]

⥅ related node [[dharani]]

⥅ related node [[dharma gates]]

⥅ related node [[dharma]]

⥅ related node [[dharmachakra]]

⥅ related node [[dialectic]]

⥅ related node [[dialectical method]]

⥅ related node [[diana]]

⥅ related node [[diaspora]]

⥅ related node [[dibi58]]

⥅ related node [[dice]]

⥅ related node [[dickfeynman5]]

⥅ related node [[did]]

⥅ related node [[didactic]]

⥅ related node [[diego de la hera]]

⥅ related node [[diegodlh]]

⥅ related node [[dielectric stacks]]

⥅ related node [[digital art]]

⥅ related node [[digital bolo]]

⥅ related node [[digital capitalism]]

⥅ related node [[digital commons coop]]

⥅ related node [[digital commons]]

⥅ related node [[digital garden configuration]]

⥅ related node [[digital garden standards]]

⥅ related node [[digital garden]]

⥅ related node [[digital gardeners]]

⥅ related node [[digital nation]]

⥅ related node [[dima]]

⥅ related node [[ding levery]]

⥅ related node [[dinner]]

⥅ related node [[diolkos]]

⥅ related node [[dios salve la flor del loto]]

⥅ related node [[directed acyclic graph]]

⥅ related node [[directories]]

⥅ related node [[diretories]]

⥅ related node [[dirichlet function]]

⥅ related node [[disable power saving]]

⥅ related node [[disassembly]]

⥅ related node [[discdag]]

⥅ related node [[disco]]

⥅ related node [[discord servers]]

⥅ related node [[discretionary budget]]

⥅ related node [[discussing social annotation and digital literacies]]

⥅ related node [[disentangle it]]

⥅ related node [[disentangling moloch]]

⥅ related node [[disfraz de tigre]]

⥅ related node [[dispatches from flancia]]

⥅ related node [[dispositio]]

⥅ related node [[distdns]]

⥅ related node [[distributed basic income]]

⥅ related node [[distributed cognition]]

⥅ related node [[distributed knowledge grap]]

⥅ related node [[distributed press 2019]]

⥅ related node [[distributed press 2021 05 19]]

⥅ related node [[distributed press]]

⥅ related node [[distributed public knowledge graph]]

⥅ related node [[distributed]]

⥅ related node [[distributopia]]

⥅ related node [[ditched slugs]]

⥅ related node [[dithmarschen]]

⥅ related node [[ditmarshians]]

⥅ related node [[diverse community of modelers]]

⥅ related node [[divinity 2 original sin]]

⥅ related node [[djvu]]

⥅ related node [[dkg]]

⥅ related node [[dmoz]]

⥅ related node [[dns]]

⥅ related node [[do done trees]]

⥅ related node [[do it]]

⥅ related node [[do the right thing]]

⥅ related node [[do your thing]]

⥅ related node [[do]]

⥅ related node [[docker]]

⥅ related node [[dockerfile]]

⥅ related node [[dockside market]]

⥅ related node [[docs to markdown]]

⥅ related node [[doctor who]]

⥅ related node [[doctorow]]

⥅ related node [[document mode]]

⥅ related node [[document]]

⥅ related node [[documentaries]]

⥅ related node [[documentary]]

⥅ related node [[documentos del club]]

⥅ related node [[dog]]

⥅ related node [[dogsheep]]

⥅ related node [[doi]]

⥅ related node [[doikayt]]

⥅ related node [[doing good better]]

⥅ related node [[doing]]

⥅ related node [[dojo dojo]]

⥅ related node [[dokieli]]

⥅ related node [[dollar auction]]

⥅ related node [[don hopkins]]

⥅ related node [[don t make me think]]

⥅ related node [[don t accept the default]]

⥅ related node [[don t worry eat curry]]

⥅ related node [[donate 25]]

⥅ related node [[donate effective altruism]]

⥅ related node [[donate give directly]]

⥅ related node [[donate]]

⥅ related node [[donde pegan dan]]

⥅ related node [[done]]

⥅ related node [[donna haraway]]

⥅ related node [[doodle alternative]]

⥅ related node [[doomsday argument]]

⥅ related node [[doqxascott]]

⥅ related node [[dora]]

⥅ related node [[dos gardenias]]

⥅ related node [[dos maitreyas]]

⥅ related node [[dos minutos]]

⥅ related node [[dotlit starter]]

⥅ related node [[dotlit]]

⥅ related node [[double crux]]

⥅ related node [[doubleloop]]

⥅ related node [[doug engelbart]]

⥅ related node [[doug holton]]

⥅ related node [[douglas adams]]

⥅ related node [[douglas crockford]]

⥅ related node [[douglas crowford]]

⥅ related node [[douglas hofstadter]]

⥅ related node [[douglas rushkoff]]

⥅ related node [[downward dog]]

⥅ related node [[dr kvj]]

⥅ related node [[dread pirate roberts]]

⥅ related node [[dream machines]]

⥅ related node [[dream]]

⥅ related node [[dreame manual]]

⥅ related node [[drishti]]

⥅ related node [[drishtis]]

⥅ related node [[drive safe homie]]

⥅ related node [[driven to distraction]]

⥅ related node [[drone zone]]

⥅ related node [[dual]]

⥅ related node [[dumb]]

⥅ related node [[duncan jones]]

⥅ related node [[dune]]

⥅ related node [[dungeons]]

⥅ related node [[dust theory]]

⥅ related node [[dust universe theory]]

⥅ related node [[dweb principles]]

⥅ related node [[dwhly]]

⥅ related node [[dying earth]]

⥅ related node [[dylan steck]]

⥅ related node [[dyokomizo flancian]]

⥅ related node [[dyokomizo]]

⥅ related node [[dystopoi]]

⥅ related node [[e acc]]

⥅ related node [[e c b]]

⥅ related node [[e c s]]

⥅ related node [[e reader]]

⥅ related node [[e2h]]

⥅ related node [[ea]]

⥅ related node [[eagxvirtual 2020]]

⥅ related node [[earth practice]]

⥅ related node [[eberhard licht]]

⥅ related node [[ebird]]

⥅ related node [[ec]]

⥅ related node [[eccentric]]

⥅ related node [[ecmascript internal property]]

⥅ related node [[ecofuturismo]]

⥅ related node [[ecogwiki]]

⥅ related node [[ed summers]]

⥅ related node [[eddie higgins]]

⥅ related node [[edge of chaos]]

⥅ related node [[edges of illusion]]

⥅ related node [[edges]]

⥅ related node [[edit the agora]]

⥅ related node [[edit]]

⥅ related node [[editar el agora]]

⥅ related node [[editing]]

⥅ related node [[edmodo]]

⥅ related node [[edn]]

⥅ related node [[edsger dijkstra]]

⥅ related node [[edsu]]

⥅ related node [[eduardo carlas sala]]

⥅ related node [[eduardo ivanec]]

⥅ related node [[eduardo mercovich]]

⥅ related node [[edumerco]]

⥅ related node [[edunev]]

⥅ related node [[efd]]

⥅ related node [[eff]]

⥅ related node [[effective altruism funds]]

⥅ related node [[effective altruism talk]]

⥅ related node [[effective altruism]]

⥅ related node [[effortless contact]]

⥅ related node [[egghead io]]

⥅ related node [[eggy egregore]]

⥅ related node [[egoposting]]

⥅ related node [[egregore]]

⥅ related node [[egypt ethiopia conflict]]

⥅ related node [[ehegattin]]

⥅ related node [[eigen]]

⥅ related node [[eigeneigen]]

⥅ related node [[eight pomodoros for the revolution]]

⥅ related node [[eight pomodoros]]

⥅ related node [[eighteenth century poetry]]

⥅ related node [[eightfold path]]

⥅ related node [[eikas]]

⥅ related node [[eionrobb]]

⥅ related node [[eip 721]]

⥅ related node [[eisejuaz]]

⥅ related node [[eishin school]]

⥅ related node [[ekumen org]]

⥅ related node [[ekumen]]

⥅ related node [[el baile moderno]]

⥅ related node [[el bolsón]]

⥅ related node [[el candor del padre brown]]

⥅ related node [[el casal catalá]]

⥅ related node [[el estado mágico]]

⥅ related node [[el evangelio del coyote]]

⥅ related node [[el narrador]]

⥅ related node [[el problema son las piedras en el camino]]

⥅ related node [[el pueblo unido jamás será vencido]]

⥅ related node [[el zorro]]

⥅ related node [[eleanor janega]]

⥅ related node [[elections]]

⥅ related node [[electric octopus]]

⥅ related node [[electrolysis]]

⥅ related node [[electronic frontier foundation]]

⥅ related node [[elena]]

⥅ related node [[elephant]]

⥅ related node [[eli]]

⥅ related node [[elicit]]

⥅ related node [[elinor ostrom]]

⥅ related node [[elk]]

⥅ related node [[ellipsis]]

⥅ related node [[ellis]]

⥅ related node [[elocutio]]

⥅ related node [[elopio]]

⥅ related node [[elsa gidlow]]

⥅ related node [[embrace capitalism]]

⥅ related node [[embryosophy]]

⥅ related node [[emerald tablet]]

⥅ related node [[emergent property]]

⥅ related node [[eminems]]

⥅ related node [[emma goldmann]]

⥅ related node [[emmy noether]]

⥅ related node [[emostaque]]

⥅ related node [[empanadas]]

⥅ related node [[empathy2000]]

⥅ related node [[employer]]

⥅ related node [[empoderadas]]

⥅ related node [[empresas b]]

⥅ related node [[emptiness]]

⥅ related node [[emre ergin]]

⥅ related node [[en flancia hay un agora]]

⥅ related node [[en flancia no hay jardines cerrados]]

⥅ related node [[enchiridion]]

⥅ related node [[encincovoy]]

⥅ related node [[encyclopedia of world problems and human potential]]

⥅ related node [[encyclopedia of world problems]]

⥅ related node [[endless forms most beautiful]]

⥅ related node [[endtroducing]]

⥅ related node [[engelbart]]

⥅ related node [[engels]]

⥅ related node [[english break well]]

⥅ related node [[english]]

⥅ related node [[enki]]

⥅ related node [[enkiv2]]

⥅ related node [[enlightenment of the internet]]

⥅ related node [[enlightenment]]

⥅ related node [[enough about human rights]]

⥅ related node [[enough brahmin]]

⥅ related node [[enough]]

⥅ related node [[enrique]]

⥅ related node [[entangled with moloch]]

⥅ related node [[entelechia]]

⥅ related node [[entelechy]]

⥅ related node [[entities can be looked up in an agora]]

⥅ related node [[entities]]

⥅ related node [[entity disambiguation]]

⥅ related node [[entity]]

⥅ related node [[entr]]

⥅ related node [[entre valles y quebradas]]

⥅ related node [[entropic brain hypothesis]]

⥅ related node [[entropy and diversity]]

⥅ related node [[entropy]]

⥅ related node [[eowpahp]]

⥅ related node [[epicureanism]]

⥅ related node [[epicurus]]

⥅ related node [[epidemic forecasting]]

⥅ related node [[epistemological letters]]

⥅ related node [[epithet]]

⥅ related node [[epoisses]]

⥅ related node [[equanimity]]

⥅ related node [[erc 721]]

⥅ related node [[eric freeman]]

⥅ related node [[eric hoffer]]

⥅ related node [[eric linus kaplan]]

⥅ related node [[eric lortie]]

⥅ related node [[eric r weinstein]]

⥅ related node [[eric raymond]]

⥅ related node [[eric weinstein with brian keating]]

⥅ related node [[eric weinstein]]

⥅ related node [[eric weistein with brian keating]]

⥅ related node [[erich auerbach]]

⥅ related node [[erik d kennedy]]

⥅ related node [[erik kennedy]]

⥅ related node [[erikallberg]]

⥅ related node [[erikdkennedy]]

⥅ related node [[erin kissane]]

⥅ related node [[eris]]

⥅ related node [[erlend]]

⥅ related node [[eroica]]

⥅ related node [[ervin nyiregyhazi]]

⥅ related node [[es]]

⥅ related node [[esalen institute]]

⥅ related node [[escenas de la novela argentina]]

⥅ related node [[escritos herèticos]]

⥅ related node [[escritos heréticos]]

⥅ related node [[escuela de aprendices]]

⥅ related node [[españa 2025]]

⥅ related node [[español]]

⥅ related node [[esr]]

⥅ related node [[essay]]

⥅ related node [[essays]]

⥅ related node [[esther dyson]]

⥅ related node [[estimate]]

⥅ related node [[estimates]]

⥅ related node [[estral]]

⥅ related node [[estructura]]

⥅ related node [[eternal september]]

⥅ related node [[ethan hamilton]]

⥅ related node [[ethan plante]]

⥅ related node [[ethan]]

⥅ related node [[etherpad plugins]]

⥅ related node [[etherpad wikilinks]]

⥅ related node [[etherpad]]

⥅ related node [[ethical license]]

⥅ related node [[ethical]]

⥅ related node [[ethiopiques]]

⥅ related node [[eudaemonia]]

⥅ related node [[eugnosia]]

⥅ related node [[eugrow]]

⥅ related node [[eutopia]]

⥅ related node [[evan boehs]]

⥅ related node [[evan thompson]]

⥅ related node [[evan]]

⥅ related node [[evanward97]]

⥅ related node [[evaricweicksel]]

⥅ related node [[evelyn]]

⥅ related node [[events]]

⥅ related node [[evercred]]

⥅ related node [[everything is a remix]]

⥅ related node [[everything]]

⥅ related node [[everything2]]

⥅ related node [[evil eye]]

⥅ related node [[ewp]]

⥅ related node [[ex astris umbra]]

⥅ related node [[ex]]

⥅ related node [[exchange formats]]

⥅ related node [[exec]]

⥅ related node [[execute]]

⥅ related node [[executive bathroom]]

⥅ related node [[exegesis]]

⥅ related node [[exercise snacks]]

⥅ related node [[exgenesis]]

⥅ related node [[existence]]

⥅ related node [[existential risk]]

⥅ related node [[existential risks]]

⥅ related node [[exists forall]]

⥅ related node [[exit voice and loyalty]]

⥅ related node [[exobrain]]

⥅ related node [[expand their circles]]

⥅ related node [[expanding circle]]

⥅ related node [[expanding the circle]]

⥅ related node [[expede]]

⥅ related node [[expendable]]

⥅ related node [[experiment framework]]

⥅ related node [[experiment]]

⥅ related node [[experimental agora]]

⥅ related node [[experimental]]

⥅ related node [[experiments server]]

⥅ related node [[experiments]]

⥅ related node [[explore]]

⥅ related node [[explorer]]

⥅ related node [[extensible data notation]]

⥅ related node [[extensible redirects]]

⥅ related node [[extension]]

⥅ related node [[external chrome extension]]

⥅ related node [[extraterritorialidad]]

⥅ related node [[extropian net]]

⥅ related node [[exuo]]

⥅ related node [[f drop]]

⥅ related node [[f s b]]

⥅ related node [[f35bf2527d7943c7a78beee799232cb4]]

⥅ related node [[fabien gandon]]

⥅ related node [[facebook is a doomsday machine]]

⥅ related node [[facebook]]

⥅ related node [[factored cognition hypothesis]]

⥅ related node [[facttic]]

⥅ related node [[fairmint]]

⥅ related node [[fakechuck]]

⥅ related node [[falafel]]

⥅ related node [[falange]]

⥅ related node [[familiar]]

⥅ related node [[family]]

⥅ related node [[fan made adventure games]]

⥅ related node [[fan]]

⥅ related node [[fantas]]

⥅ related node [[fantastic fungi]]

⥅ related node [[fascism]]

⥅ related node [[fascist]]

⥅ related node [[fascists]]

⥅ related node [[fat link]]

⥅ related node [[fat links]]

⥅ related node [[fatcat]]

⥅ related node [[fauno]]

⥅ related node [[fave]]

⥅ related node [[favorite things]]

⥅ related node [[favorite]]

⥅ related node [[favorites]]

⥅ related node [[favourite numbers]]

⥅ related node [[favourite things]]

⥅ related node [[favourite]]

⥅ related node [[favourites]]

⥅ related node [[feature requests]]

⥅ related node [[features of the agora]]

⥅ related node [[february 14th 2020]]

⥅ related node [[fed wiki]]

⥅ related node [[federalist papers]]

⥅ related node [[federated ecosystem]]

⥅ related node [[federated ecosystems]]

⥅ related node [[federated education]]

⥅ related node [[federated wiki video chat]]

⥅ related node [[federated wiki]]

⥅ related node [[federation weekly]]

⥅ related node [[federation]]

⥅ related node [[federico nietzsche]]

⥅ related node [[fediversalist papers]]

⥅ related node [[fediverse info]]

⥅ related node [[fediverse party]]

⥅ related node [[fediverse roles]]

⥅ related node [[fediverse space]]

⥅ related node [[fediverse stoa]]

⥅ related node [[fediverse]]

⥅ related node [[fedstoa bugs]]

⥅ related node [[fedwiki meet]]

⥅ related node [[fedwiki weekly]]

⥅ related node [[fedwiki]]

⥅ related node [[feedback 2024]]

⥅ related node [[feedback]]

⥅ related node [[feedparser]]

⥅ related node [[feeds]]

⥅ related node [[feenk]]

⥅ related node [[felix hoesch]]

⥅ related node [[fellini]]

⥅ related node [[fellowship of the link]]

⥅ related node [[female]]

⥅ related node [[fever]]

⥅ related node [[feynman lectures]]

⥅ related node [[ficciones]]

⥅ related node [[fichte]]

⥅ related node [[fictions that soothe]]

⥅ related node [[fifth international]]

⥅ related node [[fifth precept]]

⥅ related node [[fight procrastination]]

⥅ related node [[file handler]]

⥅ related node [[file system access api]]

⥅ related node [[filosofía para los retos contemporáneos]]

⥅ related node [[fin de semana]]

⥅ related node [[final del juego]]

⥅ related node [[fira]]

⥅ related node [[fire]]

⥅ related node [[firefox nightly]]

⥅ related node [[firefox qa]]

⥅ related node [[firefox]]

⥅ related node [[fireplace]]

⥅ related node [[first stoa]]

⥅ related node [[fission talks]]

⥅ related node [[fission whitepaper]]

⥅ related node [[fitbit]]

⥅ related node [[five o clock]]

⥅ related node [[five year plan]]

⥅ related node [[fix 500s]]

⥅ related node [[fix agorai]]

⥅ related node [[fix go links]]

⥅ related node [[fix ranking]]

⥅ related node [[fix spaces]]

⥅ related node [[fixing it]]

⥅ related node [[fka twigs]]

⥅ related node [[flaccia]]

⥅ related node [[flacia]]

⥅ related node [[flaeky pancako]]

⥅ related node [[flagcia]]

⥅ related node [[flags of flancia]]

⥅ related node [[flame]]

⥅ related node [[flan rafael]]

⥅ related node [[flanboyant]]

⥅ related node [[flanbridge]]

⥅ related node [[flancia 2022]]

⥅ related node [[flancia 2023]]

⥅ related node [[flancia book]]

⥅ related node [[flancia cantos]]

⥅ related node [[flancia collective]]

⥅ related node [[flancia coop]]

⥅ related node [[flancia discuss]]

⥅ related node [[flancia doc]]

⥅ related node [[flancia es]]

⥅ related node [[flancia foundation]]

⥅ related node [[flancia git]]

⥅ related node [[flancia goals]]

⥅ related node [[flancia governance]]

⥅ related node [[flancia home]]

⥅ related node [[flancia house]]

⥅ related node [[flancia is a pattern language]]

⥅ related node [[flancia meet notes]]

⥅ related node [[flancia meet]]

⥅ related node [[flancia meets weird]]

⥅ related node [[flancia meets]]

⥅ related node [[flancia memory palace]]

⥅ related node [[flancia narrative]]

⥅ related node [[flancia org]]

⥅ related node [[flancia pattern language]]

⥅ related node [[flancia plan]]

⥅ related node [[flancia playlist]]

⥅ related node [[flancia procedure]]

⥅ related node [[flancia repo]]

⥅ related node [[flancia revolution]]

⥅ related node [[flancia rpg]]

⥅ related node [[flancia sheet]]

⥅ related node [[flancia soundscape]]

⥅ related node [[flancia space]]

⥅ related node [[flancia subtitles]]

⥅ related node [[flancia the game]]

⥅ related node [[flancia weekly]]

⥅ related node [[flancia or [[living in the future]]

⥅ related node [[flancia or building bridges]]

⥅ related node [[flancia or in the shadow of]]

⥅ related node [[flancia or the paradise of those that might have thrived]]

⥅ related node [[flancia or the revolution against moloch]]

⥅ related node [[flancia on building bridges]]

⥅ related node [[flanciagora]]

⥅ related node [[flancian feedback]]

⥅ related node [[flancian garden]]

⥅ related node [[flancian git]]

⥅ related node [[flancian in merveilles]]

⥅ related node [[flancian pub]]

⥅ related node [[flancian repo]]

⥅ related node [[flancian revolution]]

⥅ related node [[flancian todo]]

⥅ related node [[flancian]]

⥅ related node [[flancians]]

⥅ related node [[flancias]]

⥅ related node [[flancés]]

⥅ related node [[flanes]]

⥅ related node [[flaneur browser]]

⥅ related node [[flaneurs]]

⥅ related node [[flanner]]

⥅ related node [[flanneur]]

⥅ related node [[flannit]]

⥅ related node [[flask]]

⥅ related node [[flatpak]]

⥅ related node [[flecha derecha]]

⥅ related node [[fleeky]]

⥅ related node [[flora]]

⥅ related node [[flourish]]

⥅ related node [[flourless banana bread]]

⥅ related node [[flow state radio]]

⥅ related node [[flow]]

⥅ related node [[flowed]]

⥅ related node [[flower sermon]]

⥅ related node [[flowershow]]

⥅ related node [[flutter]]

⥅ related node [[flyingcroissant]]

⥅ related node [[flâneur]]

⥅ related node [[flâneurs]]

⥅ related node [[flâneuse]]

⥅ related node [[fo guang shan]]

⥅ related node [[foaf]]

⥅ related node [[foam config]]

⥅ related node [[foam graph]]

⥅ related node [[foam settings]]

⥅ related node [[foam workspace]]

⥅ related node [[focal point]]

⥅ related node [[focus]]

⥅ related node [[fogg behavior model]]

⥅ related node [[folding t shirts]]

⥅ related node [[font of augurs]]

⥅ related node [[fonts]]

⥅ related node [[foo bar]]

⥅ related node [[foo]]

⥅ related node [[foolishowl]]

⥅ related node [[for the benefit of all beings]]

⥅ related node [[for the benefit of all sentient beings]]

⥅ related node [[for the good fo all conscious beings]]

⥅ related node [[for]]

⥅ related node [[forbrydelsen]]

⥅ related node [[force directed graphs]]

⥅ related node [[force graph]]

⥅ related node [[forest]]

⥅ related node [[forge fed]]

⥅ related node [[forge]]

⥅ related node [[forgefed]]

⥅ related node [[forges]]

⥅ related node [[forgiveness]]

⥅ related node [[fork fork fork]]

⥅ related node [[fork the agora]]

⥅ related node [[fork]]

⥅ related node [[forking paths]]

⥅ related node [[formal logic]]

⥅ related node [[formats]]

⥅ related node [[forshaper]]

⥅ related node [[forth]]

⥅ related node [[forthrighter]]

⥅ related node [[fossil]]

⥅ related node [[fotl chat]]

⥅ related node [[fotl]]

⥅ related node [[foucault s turtlenecks]]

⥅ related node [[foucault]]

⥅ related node [[foucaults turtlenecks]]

⥅ related node [[foundations of yoga]]

⥅ related node [[founder s letter]]

⥅ related node [[founders letter]]

⥅ related node [[four futures]]

⥅ related node [[four pomodoros for the kind revolution]]

⥅ related node [[four pomodoros for the revolution]]

⥅ related node [[four quadrants]]

⥅ related node [[four quartets]]

⥅ related node [[four seals]]

⥅ related node [[four]]

⥅ related node [[fourier]]

⥅ related node [[fourth international]]

⥅ related node [[fpallopides]]

⥅ related node [[fractal football]]

⥅ related node [[fractal morphism]]

⥅ related node [[fractal revolution]]

⥅ related node [[fractal yoga]]

⥅ related node [[fractal]]

⥅ related node [[fragmentary]]

⥅ related node [[fragments]]

⥅ related node [[framadate]]

⥅ related node [[framapiaf]]

⥅ related node [[framatalk]]

⥅ related node [[francis ford coppola]]

⥅ related node [[francis_miller]]

⥅ related node [[francisco franco]]

⥅ related node [[francisco varela]]

⥅ related node [[frank lloyd wright]]

⥅ related node [[frankenbook]]

⥅ related node [[frankfurt]]

⥅ related node [[frankly]]

⥅ related node [[frantz fanon]]

⥅ related node [[françoise hardy]]

⥅ related node [[fred bednarski]]

⥅ related node [[fred]]

⥅ related node [[frederick engels]]

⥅ related node [[fredgalvao]]

⥅ related node [[free access to information]]

⥅ related node [[free annotations]]

⥅ related node [[free bridges]]

⥅ related node [[free from suffering]]

⥅ related node [[free knowledge commons]]

⥅ related node [[free nfts]]

⥅ related node [[free software]]

⥅ related node [[free soundfonts]]

⥅ related node [[free time]]

⥅ related node [[free universal construction kit]]

⥅ related node [[free world charter]]

⥅ related node [[free fair and alive]]

⥅ related node [[free fair alive]]

⥅ related node [[free]]

⥅ related node [[free4talk]]

⥅ related node [[freemason]]

⥅ related node [[freenet]]

⥅ related node [[frege russell wittgenstein]]

⥅ related node [[frenemy]]

⥅ related node [[friday]]

⥅ related node [[friedrich engels]]

⥅ related node [[friedrich nietzsche]]

⥅ related node [[friend]]

⥅ related node [[friendly ambitious nerds]]

⥅ related node [[friends of god]]

⥅ related node [[friends online]]

⥅ related node [[friends]]

⥅ related node [[frinends]]

⥅ related node [[frog pocket]]

⥅ related node [[from gardens where we feel secure]]

⥅ related node [[front matter]]

⥅ related node [[frontiers of commoning]]

⥅ related node [[frulic]]

⥅ related node [[fsm]]

⥅ related node [[fuck it]]

⥅ related node [[fucking]]

⥅ related node [[fud]]

⥅ related node [[full throttle]]

⥅ related node [[full unicode]]

⥅ related node [[fully automated luxury gay space communism]]

⥅ related node [[fundació joan miró]]

⥅ related node [[fundamental theorem of finite factored sets]]

⥅ related node [[fungal empire]]

⥅ related node [[funkyduffy]]

⥅ related node [[furikake]]

⥅ related node [[future focused]]

⥅ related node [[future of knowledge]]

⥅ related node [[future of note taking]]

⥅ related node [[future project]]

⥅ related node [[future]]

⥅ related node [[fuzzy thinker]]

⥅ related node [[fwfg]]

⥅ related node [[g i]]

⥅ related node [[g k ogden]]

⥅ related node [[g ]]

⥅ related node [[gag orders]]

⥅ related node [[galactica]]

⥅ related node [[galette]]

⥅ related node [[galletitas]]

⥅ related node [[game b]]

⥅ related node [[game of life]]

⥅ related node [[game]]

⥅ related node [[gamification]]

⥅ related node [[gapufo]]

⥅ related node [[garbage collection]]

⥅ related node [[garden of forking paths]]

⥅ related node [[garden]]

⥅ related node [[gardens yaml]]

⥅ related node [[gardens]]

⥅ related node [[garethyorke]]

⥅ related node [[garment design with gans]]

⥅ related node [[gata]]

⥅ related node [[gate gate paragate parasamgate bodhi svaha]]

⥅ related node [[gather town]]

⥅ related node [[gather]]

⥅ related node [[gatopardismo]]

⥅ related node [[gauge fields knots and gravity]]

⥅ related node [[gauge fields nots and gravity]]

⥅ related node [[gauge theory]]

⥅ related node [[gc]]

⥅ related node [[gebana]]

⥅ related node [[geminagora]]

⥅ related node [[gemini agora]]

⥅ related node [[gemini]]

⥅ related node [[gemtext]]

⥅ related node [[gen studio]]

⥅ related node [[gene wolfe]]

⥅ related node [[generativist]]

⥅ related node [[genossenschaft]]

⥅ related node [[gentle revolution]]

⥅ related node [[genug brahmin]]

⥅ related node [[genug]]

⥅ related node [[geograph]]

⥅ related node [[geometric unity]]

⥅ related node [[geordie keitt]]

⥅ related node [[george anadiotis]]

⥅ related node [[george handel]]

⥅ related node [[georgo vassilis]]

⥅ related node [[gerald sussman]]

⥅ related node [[gerhard zorn]]

⥅ related node [[gerry garbulsky]]

⥅ related node [[getting warmer with jen monroe]]

⥅ related node [[gguf]]

⥅ related node [[ghost knowledge]]

⥅ related node [[giacomo sansoni]]

⥅ related node [[giant global graph]]

⥅ related node [[gift idea]]

⥅ related node [[gig]]

⥅ related node [[gigafelon]]

⥅ related node [[gimmick]]

⥅ related node [[gimmicks]]

⥅ related node [[girba]]

⥅ related node [[girlpool]]

⥅ related node [[git alias]]

⥅ related node [[git change remote]]

⥅ related node [[git config]]

⥅ related node [[git email]]

⥅ related node [[git forget conflicted 1721584183256]]

⥅ related node [[git forget]]

⥅ related node [[git on ipfs]]

⥅ related node [[git pull strategy]]

⥅ related node [[git rebase]]

⥅ related node [[git repository]]

⥅ related node [[git rere]]

⥅ related node [[git restore mtime]]

⥅ related node [[git ship]]

⥅ related node [[git stoa]]

⥅ related node [[git sync]]

⥅ related node [[gitbug]]

⥅ related node [[gitea]]

⥅ related node [[github]]

⥅ related node [[gitjournal]]

⥅ related node [[gitpod garden]]

⥅ related node [[give directly]]

⥅ related node [[giving pledge]]

⥅ related node [[giving what we can]]

⥅ related node [[glenn gould]]

⥅ related node [[global decision making via local economic transactions]]

⥅ related node [[global economic inequality]]

⥅ related node [[global health and development fund]]

⥅ related node [[global priorities institute]]

⥅ related node [[global reform and revolution]]

⥅ related node [[global risk]]

⥅ related node [[gloria a las maravillas del universo]]

⥅ related node [[gloria]]

⥅ related node [[gmail]]

⥅ related node [[gnomon chronicles]]

⥅ related node [[gnu linux]]

⥅ related node [[gnu]]

⥅ related node [[gnupg]]

⥅ related node [[go kindly]]

⥅ related node [[go link]]

⥅ related node [[go links in pushes]]

⥅ related node [[go run]]

⥅ related node [[font video]]

⥅ related node [[goblin odds]]

⥅ related node [[goblinodds]]

⥅ related node [[goldberg variations]]

⥅ related node [[goldberg]]

⥅ related node [[golden rule of rebasing]]

⥅ related node [[golink]]

⥅ related node [[gollum]]

⥅ related node [[gone beyond]]

⥅ related node [[gone for good]]

⥅ related node [[gone gone gone]]

⥅ related node [[gone gone]]

⥅ related node [[gone]]

⥅ related node [[good intent]]

⥅ related node [[good people]]

⥅ related node [[good rogues]]

⥅ related node [[good time]]

⥅ related node [[good titles]]

⥅ related node [[good]]

⥅ related node [[goodbye]]

⥅ related node [[goodreads bridge]]

⥅ related node [[goodreads export]]

⥅ related node [[goodtime]]

⥅ related node [[googlagora]]

⥅ related node [[google 12000]]

⥅ related node [[google alternatives]]

⥅ related node [[google doc]]

⥅ related node [[google docs]]

⥅ related node [[google is not a conventional company]]

⥅ related node [[google keep]]

⥅ related node [[googler]]

⥅ related node [[googles]]

⥅ related node [[gopher like]]

⥅ related node [[gopher]]

⥅ related node [[gordon brander]]

⥅ related node [[gorgias]]

⥅ related node [[gostak]]

⥅ related node [[goto coop]]

⥅ related node [[gotosocial]]

⥅ related node [[gottfried wilhelm leibniz]]

⥅ related node [[gould]]

⥅ related node [[governance layer]]

⥅ related node [[governance]]

⥅ related node [[governing the commons]]

⥅ related node [[gpg key]]

⥅ related node [[gphotos uploader cli]]

⥅ related node [[gpt 2]]

⥅ related node [[gpt 3]]

⥅ related node [[gptbr00ke]]

⥅ related node [[grabador]]

⥅ related node [[gracias a buda]]

⥅ related node [[gracias]]

⥅ related node [[gradual disclosure]]

⥅ related node [[graeber]]

⥅ related node [[grammar]]

⥅ related node [[granary io]]

⥅ related node [[grandfather]]

⥅ related node [[graphql]]

⥅ related node [[graphs]]

⥅ related node [[gravitational field]]

⥅ related node [[gray card]]

⥅ related node [[great news]]

⥅ related node [[great open source]]

⥅ related node [[great review by t sharp]]

⥅ related node [[great review by t]]

⥅ related node [[green yoga]]

⥅ related node [[green]]

⥅ related node [[greg egan]]

⥅ related node [[gregory bateson]]

⥅ related node [[grimes]]

⥅ related node [[grok activitypub]]

⥅ related node [[grok]]

⥅ related node [[grokking]]

⥅ related node [[groove salad]]

⥅ related node [[groucho marx]]

⥅ related node [[groundhog day]]

⥅ related node [[growing artificial societies]]

⥅ related node [[grumpy gamer]]

⥅ related node [[grundeinkommen initiative]]

⥅ related node [[gtd]]

⥅ related node [[gtoolkit]]

⥅ related node [[guaranteed income]]

⥅ related node [[guardian]]

⥅ related node [[guatemala]]

⥅ related node [[guerilla open access manifesto]]

⥅ related node [[gun eco]]

⥅ related node [[guo]]

⥅ related node [[guppe]]

⥅ related node [[gustav metzger]]

⥅ related node [[gustavo todo]]

⥅ related node [[gustavo]]

⥅ related node [[gutmensch]]

⥅ related node [[guybrush threepwood]]

⥅ related node [[gyokuro]]

⥅ related node [[gyuri lajos]]

⥅ related node [[gyuri]]

⥅ related node [[gérard genette]]

⥅ related node [[h art songs]]

⥅ related node [[h2g2]]

⥅ related node [[habitat 67]]

⥅ related node [[hack firefox]]

⥅ related node [[hack the internet]]

⥅ related node [[hack the planet]]

⥅ related node [[hack]]

⥅ related node [[hacker manifesto]]

⥅ related node [[hacker news]]

⥅ related node [[hacker]]

⥅ related node [[hackers heroes of the computer revolution]]

⥅ related node [[hackers]]

⥅ related node [[hacking in progress]]

⥅ related node [[hacking]]

⥅ related node [[hackmd]]

⥅ related node [[hacky]]

⥅ related node [[half earth socialism]]

⥅ related node [[halikaarn1an]]

⥅ related node [[hamnox]]

⥅ related node [[handlerug]]

⥅ related node [[handshake]]

⥅ related node [[hannah arendt]]

⥅ related node [[hans widmer]]

⥅ related node [[happy]]

⥅ related node [[hardturm]]

⥅ related node [[hark a vagrant]]

⥅ related node [[harmony seeking computation]]

⥅ related node [[harmony seeking computations]]

⥅ related node [[harmonylion1]]

⥅ related node [[harvey michael]]

⥅ related node [[harveykrishna]]

⥅ related node [[hashing function]]

⥅ related node [[hashtags]]

⥅ related node [[hate]]

⥅ related node [[hathitrust]]

⥅ related node [[hccb]]

⥅ related node [[headscale]]

⥅ related node [[healthy internet]]

⥅ related node [[heart opener]]

⥅ related node [[heart sutra]]

⥅ related node [[heart]]

⥅ related node [[heather marsh]]

⥅ related node [[heavy dumbells]]

⥅ related node [[hedgedoc wikilinks]]

⥅ related node [[hedgedoc]]

⥅ related node [[hellthread]]

⥅ related node [[helm]]

⥅ related node [[help aldhari]]

⥅ related node [[help others]]

⥅ related node [[help]]

⥅ related node [[helveta]]

⥅ related node [[helvetas]]

⥅ related node [[hemppa]]

⥅ related node [[henning sammlung]]

⥅ related node [[henry darger]]

⥅ related node [[heptades]]

⥅ related node [[herbert simon]]

⥅ related node [[herbert von karajan]]

⥅ related node [[here]]

⥅ related node [[heretics society]]

⥅ related node [[hershel of ostropol]]

⥅ related node [[herzpraxis]]

⥅ related node [[heterarchical ontology]]

⥅ related node [[heterarchical]]

⥅ related node [[heterarchy]]

⥅ related node [[hexagons are the bestagons]]

⥅ related node [[hftf]]

⥅ related node [[hide tabs in firefox]]

⥅ related node [[hierarchies]]

⥅ related node [[hierarchy]]

⥅ related node [[high capacity color barcode]]

⥅ related node [[high stakes worldview]]

⥅ related node [[higher and lower pleasures]]

⥅ related node [[higher consciousness]]

⥅ related node [[hillel the elder]]

⥅ related node [[hippie speedball]]

⥅ related node [[hipster sound]]

⥅ related node [[hiroshi yoshimura]]

⥅ related node [[historias de cronopios y de famas]]

⥅ related node [[historical agora]]

⥅ related node [[hmu]]

⥅ related node [[hn alternatives]]

⥅ related node [[hn thread on twitter requiring login]]

⥅ related node [[hn]]

⥅ related node [[hofstadter]]

⥅ related node [[hohenzollern castle]]

⥅ related node [[holacracy]]

⥅ related node [[holepunch]]

⥅ related node [[holonomy]]

⥅ related node [[hometown]]

⥅ related node [[honest signals]]

⥅ related node [[hope or hype for art]]

⥅ related node [[hopscotch]]

⥅ related node [[horarios]]

⥅ related node [[horas canónicas]]

⥅ related node [[houshuang]]

⥅ related node [[housing underlay]]

⥅ related node [[how can we develop transformative tools for thought]]

⥅ related node [[how can we develop transformative tools for thought?]]

⥅ related node [[how do you attach images in logseq]]

⥅ related node [[how it should be]]

⥅ related node [[how many tabs do you have open]]

⥅ related node [[how tech loses out]]

⥅ related node [[how to become a flancian]]

⥅ related node [[how to feed 10 billion people]]

⥅ related node [[how to gpt 2]]

⥅ related node [[how to learn scala]]

⥅ related node [[how to make almost anything]]

⥅ related node [[how to read a book]]

⥅ related node [[how to resist amazon and why]]

⥅ related node [[how to self publish a book]]

⥅ related node [[how to start a new country]]

⥅ related node [[how to write a caron in linux]]

⥅ related node [[howard rheingold]]

⥅ related node [[howl]]

⥅ related node [[hpec cto]]

⥅ related node [[hpec]]

⥅ related node [[hpi]]

⥅ related node [[http]]

⥅ related node [[hubert dreyfus]]

⥅ related node [[huerta común]]

⥅ related node [[hugging puppy]]

⥅ related node [[huggingtweets]]

⥅ related node [[hugo boss]]

⥅ related node [[human computer interaction]]

⥅ related node [[human right]]

⥅ related node [[human rights]]

⥅ related node [[humane tech]]

⥅ related node [[humanetech]]

⥅ related node [[humanists]]

⥅ related node [[humanity]]

⥅ related node [[humble]]

⥅ related node [[hummus]]

⥅ related node [[huneker scale]]

⥅ related node [[hunger]]

⥅ related node [[husserl]]

⥅ related node [[huxley]]

⥅ related node [[hypatia]]

⥅ related node [[hype man]]

⥅ related node [[hyper]]

⥅ related node [[hyperanomalous]]

⥅ related node [[hyperbee]]

⥅ related node [[hypercore proto]]

⥅ related node [[hypercore protocol]]

⥅ related node [[hypercore]]

⥅ related node [[hypercorehh]]

⥅ related node [[hypergraph categories]]

⥅ related node [[hypergraph]]

⥅ related node [[hypergraphs]]

⥅ related node [[hyperion]]

⥅ related node [[hyperknowledge]]

⥅ related node [[hyperlink delusion]]

⥅ related node [[hyperlink]]

⥅ related node [[hypha coop]]

⥅ related node [[hypha#coop]]

⥅ related node [[hypha]]

⥅ related node [[hypnagogic]]

⥅ related node [[hypotheis]]

⥅ related node [[hypothes is]]

⥅ related node [[hypotheses]]

⥅ related node [[hypothesis 101]]

⥅ related node [[hypothesis extension]]

⥅ related node [[hypothesis intro]]

⥅ related node [[hypothesis roam bridge]]

⥅ related node [[hzian]]

⥅ related node [[höllgrotten]]

⥅ related node [[i am cuba]]

⥅ related node [[i am not a straussian]]

⥅ related node [[i annotate 2021 slides]]

⥅ related node [[i annotate 2021]]

⥅ related node [[i annotate]]

⥅ related node [[i ching lite]]

⥅ related node [[i ching]]

⥅ related node [[i closed a lot of browser tabs]]

⥅ related node [[i could node in the agora all day and all night]]

⥅ related node [[i forget]]

⥅ related node [[i lie here in a strange girl s apartment]]

⥅ related node [[i like static]]

⥅ related node [[i ll kill your shining lights]]

⥅ related node [[i love you]]

⥅ related node [[i should remember this]]

⥅ related node [[i take full responsibility]]

⥅ related node [[i want to inspire others the same way that others inspire me]]

⥅ related node [[i will _show you_ the shape of my heart]]

⥅ related node [[i will do what i can if i have to]]

⥅ related node [[i will do what i want]]

⥅ related node [[i will show you the shape of my heart]]

⥅ related node [[i m back]]

⥅ related node [[i3 resurrect]]

⥅ related node [[i3]]

⥅ related node [[iap 2021]]

⥅ related node [[iap21]]

⥅ related node [[iced quinn]]

⥅ related node [[icnu]]

⥅ related node [[idea market]]

⥅ related node [[idea]]

⥅ related node [[ideamarkets]]

⥅ related node [[identities]]

⥅ related node [[identity services]]

⥅ related node [[identity]]

⥅ related node [[iem]]

⥅ related node [[if i had the means i d build an agora]]

⥅ related node [[if i made a go for it]]

⥅ related node [[if you want to share]]

⥅ related node [[iframe]]

⥅ related node [[iframes]]

⥅ related node [[igor lenterman]]

⥅ related node [[ii]]

⥅ related node [[iii]]

⥅ related node [[ijeoma oluo]]

⥅ related node [[ikea förhöja]]

⥅ related node [[ikesharpless]]

⥅ related node [[ikigai]]

⥅ related node [[ikiru]]

⥅ related node [[ikko tanaka]]

⥅ related node [[ikuru]]

⥅ related node [[illuminations]]

⥅ related node [[image channels tool]]

⥅ related node [[imageflow]]

⥅ related node [[imagesnippets]]

⥅ related node [[immers space]]

⥅ related node [[imperial college tracker]]

⥅ related node [[implement]]

⥅ related node [[implementation intention]]

⥅ related node [[important]]

⥅ related node [[impro]]

⥅ related node [[in an endearing]]

⥅ related node [[in bloom]]

⥅ related node [[in buddha s words]]

⥅ related node [[in flancia one day we ll meet]]

⥅ related node [[in flancia there are digital heterarchies]]

⥅ related node [[in flancia there are few walled gardens]]

⥅ related node [[in flancia there are no hierarchies]]

⥅ related node [[in flancia there are no walled gardens]]

⥅ related node [[in flancia there is an agora]]

⥅ related node [[in flancia there is no poverty]]

⥅ related node [[in flancia we will meet]]

⥅ related node [[in flancia we ll thrive]]

⥅ related node [[in flancia world government is bootstrapped through a global social network implementing liquid democracy and rational heterarchies]]

⥅ related node [[in my mind]]

⥅ related node [[in praise of idleness]]

⥅ related node [[in the arcades]]

⥅ related node [[in the beginning was the command line]]

⥅ related node [[in the wilderless]]

⥅ related node [[inaturalist]]

⥅ related node [[inaya]]

⥅ related node [[2024 05 04]]

⥅ related node [[inclusionism]]

⥅ related node [[incremental basic income]]

⥅ related node [[incremental eutopia]]

⥅ related node [[incremental]]

⥅ related node [[indian food]]

⥅ related node [[indiana jones]]

⥅ related node [[indie hackers]]

⥅ related node [[indie web]]

⥅ related node [[indiehub]]

⥅ related node [[indra s net]]

⥅ related node [[indras net]]

⥅ related node [[indy3]]

⥅ related node [[infinite pomodoros]]

⥅ related node [[infinity of paths]]

⥅ related node [[infinity project]]

⥅ related node [[info hazard]]

⥅ related node [[info hazards]]

⥅ related node [[info healers]]

⥅ related node [[information as fundamental]]

⥅ related node [[information science]]

⥅ related node [[information]]

⥅ related node [[infragora]]

⥅ related node [[infranaut]]

⥅ related node [[init]]

⥅ related node [[initial public values]]

⥅ related node [[inkdrop]]

⥅ related node [[innovation information initiative]]

⥅ related node [[innovator s dilemma]]

⥅ related node [[inosculation]]

⥅ related node [[inside]]

⥅ related node [[install poetry]]

⥅ related node [[instance]]

⥅ related node [[instant commons]]

⥅ related node [[instinctive sleeping and resting postures]]

⥅ related node [[institute for the future]]

⥅ related node [[instrumental electronic music]]

⥅ related node [[integrated repository]]

⥅ related node [[integrated]]

⥅ related node [[integrationism]]

⥅ related node [[intelectualmathematics]]

⥅ related node [[intent based automation]]

⥅ related node [[intent driven automation]]

⥅ related node [[intent]]

⥅ related node [[intention]]

⥅ related node [[intentional communities]]

⥅ related node [[intentional society]]

⥅ related node [[intentions]]

⥅ related node [[intents]]

⥅ related node [[inter wiki]]

⥅ related node [[interacción humana]]

⥅ related node [[interaction]]

⥅ related node [[interactive philosophers graph]]

⥅ related node [[interesting]]

⥅ related node [[interintellect]]

⥅ related node [[interlace]]

⥅ related node [[interlay]]

⥅ related node [[internal chrome extension]]

⥅ related node [[international journal of the commons]]

⥅ related node [[international women day]]

⥅ related node [[international workers day]]

⥅ related node [[international yoga day]]

⥅ related node [[internet archive blog]]

⥅ related node [[internet archive]]

⥅ related node [[internet citizen]]

⥅ related node [[internet in a box]]

⥅ related node [[internet renaissance]]

⥅ related node [[internet]]

⥅ related node [[interop]]

⥅ related node [[interplanetary mind map]]

⥅ related node [[interpreting islam]]

⥅ related node [[interstar]]

⥅ related node [[intertwingularity]]

⥅ related node [[interview with the vampire]]

⥅ related node [[interview]]

⥅ related node [[inthistogetheramerica org]]

⥅ related node [[inti illimani]]

⥅ related node [[introduction to algorithms]]

⥅ related node [[introduction]]

⥅ related node [[inventio]]

⥅ related node [[invention]]

⥅ related node [[ios]]

⥅ related node [[iosevka]]

⥅ related node [[ipfs backend for tiddlywiki]]

⥅ related node [[ipfs search]]

⥅ related node [[ipld]]

⥅ related node [[iplumb3r]]

⥅ related node [[irc]]

⥅ related node [[iremos juntos hasta el final de la noche]]

⥅ related node [[irenes]]

⥅ related node [[irimi1]]

⥅ related node [[iron absorption]]

⥅ related node [[ishmael]]

⥅ related node [[iso 8601]]

⥅ related node [[isomorphic git]]

⥅ related node [[isomorphisms]]

⥅ related node [[it was in antiflancia that i saw the agora]]

⥅ related node [[itam]]

⥅ related node [[itertools]]

⥅ related node [[ivan herman]]

⥅ related node [[ivan ilich]]

⥅ related node [[ivo velitchkov]]

⥅ related node [[ivo]]

⥅ related node [[izzy swart]]

⥅ related node [[j posadas]]

⥅ related node [[j m w turner]]

⥅ related node [[j0lms]]

⥅ related node [[jab code]]

⥅ related node [[jab]]

⥅ related node [[jack park]]

⥅ related node [[jainism]]

⥅ related node [[jakeisnt]]

⥅ related node [[jambarree]]

⥅ related node [[james baker]]

⥅ related node [[james fodor]]

⥅ related node [[james gleick]]

⥅ related node [[james joyce s grave]]

⥅ related node [[james joyce]]

⥅ related node [[james lu]]

⥅ related node [[janastu]]

⥅ related node [[janet]]

⥅ related node [[janique behman]]

⥅ related node [[january 2022]]

⥅ related node [[january 2025]]

⥅ related node [[japan 2024]]

⥅ related node [[japan trip]]

⥅ related node [[japanese garden]]

⥅ related node [[jaras]]

⥅ related node [[jardin cerrado]]

⥅ related node [[jarke wharton]]

⥅ related node [[jarkko oikarinen]]

⥅ related node [[jasonksackey]]

⥅ related node [[jauntywunderkind]]

⥅ related node [[java assignment]]

⥅ related node [[javascript subnodes]]

⥅ related node [[jayu]]

⥅ related node [[jazz at the pawnshop]]

⥅ related node [[jdoe]]

⥅ related node [[jdrake3t]]

⥅ related node [[jean françois lyotard]]

⥅ related node [[jean michel jarre]]

⥅ related node [[jed mckenna]]

⥅ related node [[jeff tang]]

⥅ related node [[jehovah s witnesses]]

⥅ related node [[jekyll wikilinks]]

⥅ related node [[jenae cohn]]

⥅ related node [[jennifer rygh]]

⥅ related node [[jeremy ruston]]

⥅ related node [[jeri ryan]]

⥅ related node [[jerry michalski]]

⥅ related node [[jerry s brain]]

⥅ related node [[jerry]]

⥅ related node [[jerusalem]]

⥅ related node [[jerárquico]]

⥅ related node [[jesse li]]

⥅ related node [[jesus]]

⥅ related node [[jevakallio]]

⥅ related node [[jevons paradox]]

⥅ related node [[jhana inflation]]

⥅ related node [[jhanas]]

⥅ related node [[jigme rinpoche]]

⥅ related node [[jigme]]

⥅ related node [[jin war]]

⥅ related node [[jinwar]]

⥅ related node [[jitsi instances]]

⥅ related node [[jitsi meet]]

⥅ related node [[jitsi]]

⥅ related node [[jlaurelc]]

⥅ related node [[joan miro]]

⥅ related node [[job]]

⥅ related node [[joe cool]]

⥅ related node [[joe holder]]

⥅ related node [[joecool]]

⥅ related node [[joel chan]]

⥅ related node [[joel gustafson]]

⥅ related node [[joey savoie]]

⥅ related node [[john borthwick]]

⥅ related node [[john brown]]

⥅ related node [[john coltrane]]

⥅ related node [[john cowper powys]]

⥅ related node [[john holloway]]

⥅ related node [[john huang]]

⥅ related node [[john ii komnenos]]

⥅ related node [[john ingalls]]

⥅ related node [[john of nepomuk]]

⥅ related node [[john ono]]

⥅ related node [[john perry barlow]]

⥅ related node [[john the baptist]]

⥅ related node [[john von neumann]]

⥅ related node [[johnny mnemonic]]

⥅ related node [[join the agora]]

⥅ related node [[join]]

⥅ related node [[jonathan aquino]]

⥅ related node [[jonathan lorand]]

⥅ related node [[jonathan the utopian]]

⥅ related node [[jonathan]]

⥅ related node [[jonesian]]

⥅ related node [[jonny saunders]]

⥅ related node [[jonny]]

⥅ related node [[joom]]

⥅ related node [[jordan peterson]]

⥅ related node [[jorge barón biza]]

⥅ related node [[jorge bolet]]

⥅ related node [[jorge luis borges]]

⥅ related node [[joscha bach]]

⥅ related node [[josh rowell]]

⥅ related node [[joshua]]

⥅ related node [[josé rené ivanec]]

⥅ related node [[jotaemei]]

⥅ related node [[journal has been rotated since unit was started]]

⥅ related node [[journal]]

⥅ related node [[2021 08 01]]

⥅ related node [[2021 08 02]]

⥅ related node [[2021 08 03]]

⥅ related node [[2021 08 04]]

⥅ related node [[2021 08 05]]

⥅ related node [[2021 08 06]]

⥅ related node [[2021 08 07]]

⥅ related node [[2021 08 08]]

⥅ related node [[2021 08 09]]

⥅ related node [[2021 08 10]]

⥅ related node [[2021 08 11]]

⥅ related node [[2021 08 12]]

⥅ related node [[2021 08 13]]

⥅ related node [[2021 08 14]]

⥅ related node [[2021 08 15]]

⥅ related node [[2021 08 16]]

⥅ related node [[2021 08 17]]

⥅ related node [[2021 08 18]]

⥅ related node [[2021 08 20]]

⥅ related node [[2021 08 25]]

⥅ related node [[2021 08 27]]

⥅ related node [[2021 08 28]]

⥅ related node [[2021 08 29]]

⥅ related node [[2021 08 30]]

⥅ related node [[2021 08 31]]

⥅ related node [[2021 09 02]]

⥅ related node [[2021 09 04]]

⥅ related node [[2021 09 05]]

⥅ related node [[2021 09 06]]

⥅ related node [[2021 09 10]]

⥅ related node [[2021 09 11]]

⥅ related node [[2021 09 12]]

⥅ related node [[2021 09 13]]

⥅ related node [[2021 09 16]]

⥅ related node [[2021 09 17]]

⥅ related node [[2021 09 18]]

⥅ related node [[2021 09 19]]

⥅ related node [[2021 09 20]]

⥅ related node [[2021 09 22]]

⥅ related node [[2021 09 23]]

⥅ related node [[2021 09 24]]

⥅ related node [[2021 09 25]]

⥅ related node [[2021 09 26]]

⥅ related node [[2021 09 27]]

⥅ related node [[2021 09 28]]

⥅ related node [[2021 09 29]]

⥅ related node [[2021 09 30]]

⥅ related node [[2021 10 01]]

⥅ related node [[2021 10 02]]

⥅ related node [[2021 10 03]]

⥅ related node [[2021 10 04]]

⥅ related node [[2021 10 06]]

⥅ related node [[2021 10 07]]

⥅ related node [[2021 10 08]]

⥅ related node [[2021 10 09]]

⥅ related node [[2021 10 10]]

⥅ related node [[2021 10 13]]

⥅ related node [[2021 10 14]]

⥅ related node [[2021 10 15]]

⥅ related node [[2021 10 16]]

⥅ related node [[2021 10 17]]

⥅ related node [[2021 10 18]]

⥅ related node [[2021 10 19]]

⥅ related node [[2021 10 20]]

⥅ related node [[2021 10 21]]

⥅ related node [[2021 10 22]]

⥅ related node [[2021 10 23]]

⥅ related node [[2021 10 24]]

⥅ related node [[2021 10 27]]

⥅ related node [[2021 10 28]]

⥅ related node [[2021 10 29]]

⥅ related node [[2021 10 30]]

⥅ related node [[2021 10 31]]

⥅ related node [[2021 11 01]]

⥅ related node [[2021 11 02]]

⥅ related node [[2021 11 04]]

⥅ related node [[2021 11 05]]

⥅ related node [[2021 11 06]]

⥅ related node [[2021 11 07]]

⥅ related node [[2021 11 08]]

⥅ related node [[2021 11 10]]

⥅ related node [[2021 11 11]]

⥅ related node [[2021 11 13]]

⥅ related node [[2021 11 14]]

⥅ related node [[2021 11 16]]

⥅ related node [[2021 11 19]]

⥅ related node [[2021 11 20]]

⥅ related node [[2021 11 21]]

⥅ related node [[2021 11 22]]

⥅ related node [[2021 11 23]]

⥅ related node [[2021 11 24]]

⥅ related node [[2021 11 25]]

⥅ related node [[2021 11 26]]

⥅ related node [[2021 11 28]]

⥅ related node [[2021 12 01]]

⥅ related node [[2021 12 02]]

⥅ related node [[2021 12 03]]

⥅ related node [[2021 12 04]]

⥅ related node [[2021 12 05]]

⥅ related node [[2021 12 09]]

⥅ related node [[2021 12 10]]

⥅ related node [[2021 12 11]]

⥅ related node [[2021 12 12]]

⥅ related node [[2021 12 13]]

⥅ related node [[2021 12 14]]

⥅ related node [[2021 12 16]]

⥅ related node [[2021 12 18]]

⥅ related node [[2021 12 19]]

⥅ related node [[2021 12 21]]

⥅ related node [[2021 12 22]]

⥅ related node [[2021 12 23]]

⥅ related node [[2021 12 24]]

⥅ related node [[2021 12 25]]

⥅ related node [[2021 12 26]]

⥅ related node [[2021 12 27]]

⥅ related node [[2021 12 28]]

⥅ related node [[2021 12 29]]

⥅ related node [[2021 12 30]]

⥅ related node [[2021 12 31]]

⥅ related node [[2022 01 01]]

⥅ related node [[2022 01 02]]

⥅ related node [[2022 01 03]]

⥅ related node [[2022 01 04]]

⥅ related node [[2022 01 06]]

⥅ related node [[2022 01 07]]

⥅ related node [[2022 01 08]]

⥅ related node [[2022 01 09]]

⥅ related node [[2022 01 10]]

⥅ related node [[2022 01 11]]

⥅ related node [[2022 01 12]]

⥅ related node [[2022 01 13]]

⥅ related node [[2022 01 14]]

⥅ related node [[2022 01 15]]

⥅ related node [[2022 01 16]]

⥅ related node [[2022 01 17]]

⥅ related node [[2022 01 18]]

⥅ related node [[2022 01 19]]

⥅ related node [[2022 01 20]]

⥅ related node [[2022 01 21]]

⥅ related node [[2022 01 22]]

⥅ related node [[2022 01 23]]

⥅ related node [[2022 01 24]]

⥅ related node [[2022 01 25]]

⥅ related node [[2022 01 26]]

⥅ related node [[2022 01 27]]

⥅ related node [[2022 01 28]]

⥅ related node [[2022 01 29]]

⥅ related node [[2022 01 30]]

⥅ related node [[2022 01 31]]

⥅ related node [[2022 02 01]]

⥅ related node [[2022 02 02]]

⥅ related node [[2022 02 06]]

⥅ related node [[2022 02 07]]

⥅ related node [[2022 02 09]]

⥅ related node [[2022 02 11]]

⥅ related node [[2022 02 12]]

⥅ related node [[2022 02 14]]

⥅ related node [[2022 03 02]]

⥅ related node [[2022 04 15]]

⥅ related node [[2022 04 20]]

⥅ related node [[2022 04 24]]

⥅ related node [[2022 05 14]]

⥅ related node [[2022 05 17]]

⥅ related node [[2022 05 18]]

⥅ related node [[2022 05 19]]

⥅ related node [[2022 05 20]]

⥅ related node [[2022 05 21]]

⥅ related node [[2022 05 22]]

⥅ related node [[2022 05 24]]

⥅ related node [[2022 05 25]]

⥅ related node [[2022 05 26]]

⥅ related node [[2022 05 27]]

⥅ related node [[2022 05 28]]

⥅ related node [[2022 05 29]]

⥅ related node [[2022 05 30]]

⥅ related node [[2022 05 31]]

⥅ related node [[2022 06 01]]

⥅ related node [[2022 06 02]]

⥅ related node [[2022 06 03]]

⥅ related node [[2022 06 04]]

⥅ related node [[2022 06 05]]

⥅ related node [[2022 06 06]]

⥅ related node [[2022 06 07]]

⥅ related node [[2022 06 09]]

⥅ related node [[2022 06 10]]

⥅ related node [[2022 06 11]]

⥅ related node [[2022 06 12]]

⥅ related node [[2022 06 13]]

⥅ related node [[2022 06 14]]

⥅ related node [[2022 06 15]]

⥅ related node [[2022 06 16]]

⥅ related node [[2022 06 17]]

⥅ related node [[2022 06 18]]

⥅ related node [[2022 06 19]]

⥅ related node [[2022 06 22]]

⥅ related node [[2022 06 23]]

⥅ related node [[2022 06 24]]

⥅ related node [[2022 06 25]]

⥅ related node [[2022 06 26]]

⥅ related node [[2022 06 27]]

⥅ related node [[2022 06 28]]

⥅ related node [[2022 06 29]]

⥅ related node [[2022 06 30]]

⥅ related node [[2022 07 01]]

⥅ related node [[2022 07 02]]

⥅ related node [[2022 07 03]]

⥅ related node [[2022 07 04]]

⥅ related node [[2022 07 05]]

⥅ related node [[2022 07 06]]

⥅ related node [[2022 07 07]]

⥅ related node [[2022 07 08]]

⥅ related node [[2022 07 09]]

⥅ related node [[2022 07 10]]

⥅ related node [[2022 07 11]]

⥅ related node [[2022 07 12]]

⥅ related node [[2022 07 13]]

⥅ related node [[2022 07 15]]

⥅ related node [[2022 07 16]]

⥅ related node [[2022 07 17]]

⥅ related node [[2022 07 18]]

⥅ related node [[2022 07 19]]

⥅ related node [[2022 07 20]]

⥅ related node [[2022 07 21]]

⥅ related node [[2022 07 22]]

⥅ related node [[2022 07 23]]

⥅ related node [[2022 07 24]]

⥅ related node [[2022 07 25]]

⥅ related node [[2022 07 27]]

⥅ related node [[2022 07 28]]

⥅ related node [[2022 07 29]]

⥅ related node [[2022 07 30]]

⥅ related node [[2022 07 31]]

⥅ related node [[2022 08 01]]

⥅ related node [[2022 08 02]]

⥅ related node [[2022 08 03]]

⥅ related node [[2022 08 04]]

⥅ related node [[2022 08 05]]

⥅ related node [[2022 08 06]]

⥅ related node [[2022 08 07]]

⥅ related node [[2022 08 08]]

⥅ related node [[2022 08 09]]

⥅ related node [[2022 08 10]]

⥅ related node [[2022 08 11]]

⥅ related node [[2022 08 12]]

⥅ related node [[2022 08 13]]

⥅ related node [[2022 08 14]]

⥅ related node [[2022 08 15]]

⥅ related node [[2022 08 16]]

⥅ related node [[2022 08 17]]

⥅ related node [[2022 08 18]]

⥅ related node [[2022 08 19]]

⥅ related node [[2022 08 20]]

⥅ related node [[2022 08 21]]

⥅ related node [[2022 08 22]]

⥅ related node [[2022 08 23]]

⥅ related node [[2022 08 24]]

⥅ related node [[2022 08 25]]

⥅ related node [[2022 08 26]]

⥅ related node [[2022 08 27]]

⥅ related node [[2022 08 28]]

⥅ related node [[2022 08 29]]

⥅ related node [[2022 08 30]]

⥅ related node [[2022 08 31]]

⥅ related node [[2022 09 01]]

⥅ related node [[2022 09 02]]

⥅ related node [[2022 09 03]]

⥅ related node [[2022 09 04]]

⥅ related node [[2022 09 05]]

⥅ related node [[2022 09 06]]

⥅ related node [[2022 09 07]]

⥅ related node [[2022 09 08]]

⥅ related node [[2022 09 09]]

⥅ related node [[2022 09 10]]

⥅ related node [[2022 09 11]]

⥅ related node [[2022 09 12]]

⥅ related node [[2022 09 13]]

⥅ related node [[2022 09 14]]

⥅ related node [[2022 09 15]]

⥅ related node [[2022 09 16]]

⥅ related node [[2022 09 17]]

⥅ related node [[2022 09 18]]

⥅ related node [[2022 09 19]]

⥅ related node [[2022 09 20]]

⥅ related node [[2022 09 21]]

⥅ related node [[2022 09 22]]

⥅ related node [[2022 09 23]]

⥅ related node [[2022 09 24]]

⥅ related node [[2022 09 25]]

⥅ related node [[2022 09 26]]

⥅ related node [[2022 09 27]]

⥅ related node [[2022 09 28]]

⥅ related node [[2022 09 29]]

⥅ related node [[2022 10 01]]

⥅ related node [[2022 10 02]]

⥅ related node [[2022 10 03]]

⥅ related node [[2022 10 04]]

⥅ related node [[2022 10 05]]

⥅ related node [[2022 10 08]]

⥅ related node [[2022 10 09]]

⥅ related node [[2022 10 10]]

⥅ related node [[2022 10 11]]

⥅ related node [[2022 10 13]]

⥅ related node [[2022 10 14]]

⥅ related node [[2022 10 15]]

⥅ related node [[2022 10 16]]

⥅ related node [[2022 10 17]]

⥅ related node [[2022 10 18]]

⥅ related node [[2022 10 19]]

⥅ related node [[2022 10 21]]

⥅ related node [[2022 10 22]]

⥅ related node [[2022 10 23]]

⥅ related node [[2022 10 24]]

⥅ related node [[2022 10 25]]

⥅ related node [[2022 10 26]]

⥅ related node [[2022 10 27]]

⥅ related node [[2022 10 28]]

⥅ related node [[2022 10 29]]

⥅ related node [[2022 10 31]]

⥅ related node [[2022 11 02]]

⥅ related node [[2022 11 03]]

⥅ related node [[2022 11 04]]

⥅ related node [[2022 11 05]]

⥅ related node [[2022 11 06]]

⥅ related node [[2022 11 07]]

⥅ related node [[2022 11 08]]

⥅ related node [[2022 11 09]]

⥅ related node [[2022 11 10]]

⥅ related node [[2022 11 11]]

⥅ related node [[2022 11 13]]

⥅ related node [[2022 11 14]]

⥅ related node [[2022 11 15]]

⥅ related node [[2022 11 16]]

⥅ related node [[2022 11 17]]

⥅ related node [[2022 11 18]]

⥅ related node [[2022 11 19]]

⥅ related node [[2022 11 20]]

⥅ related node [[2022 11 22]]

⥅ related node [[2022 11 23]]

⥅ related node [[2022 11 25]]

⥅ related node [[2022 11 26]]

⥅ related node [[2022 11 27]]

⥅ related node [[2022 11 28]]

⥅ related node [[2022 11 29]]

⥅ related node [[2022 11 30]]

⥅ related node [[2022 12 01]]

⥅ related node [[2022 12 03]]

⥅ related node [[2022 12 04]]

⥅ related node [[2022 12 05]]

⥅ related node [[2022 12 06]]

⥅ related node [[2022 12 07]]

⥅ related node [[2022 12 08]]

⥅ related node [[2022 12 09]]

⥅ related node [[2022 12 10]]

⥅ related node [[2022 12 11]]

⥅ related node [[2022 12 12]]

⥅ related node [[2022 12 14]]

⥅ related node [[2022 12 15]]

⥅ related node [[2022 12 16]]

⥅ related node [[2022 12 17]]

⥅ related node [[2022 12 18]]

⥅ related node [[2022 12 19]]

⥅ related node [[2022 12 20]]

⥅ related node [[2022 12 21]]

⥅ related node [[2022 12 22]]

⥅ related node [[2022 12 23]]

⥅ related node [[2022 12 24]]

⥅ related node [[2022 12 25]]

⥅ related node [[2022 12 26]]

⥅ related node [[2022 12 27]]

⥅ related node [[2022 12 28]]

⥅ related node [[2022 12 29]]

⥅ related node [[2022 12 30]]

⥅ related node [[2022 12 31]]

⥅ related node [[2022 02 15]]

⥅ related node [[2022 02 16]]

⥅ related node [[2022 02 17]]

⥅ related node [[2022 02 18]]

⥅ related node [[2022 02 19]]

⥅ related node [[2022 02 20]]

⥅ related node [[2022 02 21]]

⥅ related node [[2022 02 23]]

⥅ related node [[2022 02 24]]

⥅ related node [[2022 02 25]]

⥅ related node [[2022 02 26]]

⥅ related node [[2022 02 27]]

⥅ related node [[2022 02 28]]

⥅ related node [[2022 03 01]]

⥅ related node [[2022 03 03]]

⥅ related node [[2022 03 04]]

⥅ related node [[2022 03 05]]

⥅ related node [[2022 03 06]]

⥅ related node [[2022 03 07]]

⥅ related node [[2022 03 09]]

⥅ related node [[2022 03 10]]

⥅ related node [[2022 03 11]]

⥅ related node [[2022 03 12]]

⥅ related node [[2022 03 13]]

⥅ related node [[2022 03 14]]

⥅ related node [[2022 03 15]]

⥅ related node [[2022 03 16]]

⥅ related node [[2022 03 17]]

⥅ related node [[2022 03 18]]

⥅ related node [[2022 03 19]]

⥅ related node [[2022 03 20]]

⥅ related node [[2022 03 21]]

⥅ related node [[2022 03 22]]

⥅ related node [[2022 03 23]]

⥅ related node [[2022 03 24]]

⥅ related node [[2022 03 25]]

⥅ related node [[2022 03 27]]

⥅ related node [[2022 03 28]]

⥅ related node [[2022 03 29]]

⥅ related node [[2022 03 31]]

⥅ related node [[2022 04 01]]

⥅ related node [[2022 04 02]]

⥅ related node [[2022 04 03]]

⥅ related node [[2022 04 05]]

⥅ related node [[2022 04 06]]

⥅ related node [[2022 04 07]]

⥅ related node [[2022 04 08]]

⥅ related node [[2022 04 09]]

⥅ related node [[2022 04 11]]

⥅ related node [[2022 04 12]]

⥅ related node [[2022 04 13]]

⥅ related node [[2022 04 16]]

⥅ related node [[2022 04 25]]

⥅ related node [[2022 04 27]]

⥅ related node [[2022 04 28]]

⥅ related node [[2022 04 29]]

⥅ related node [[2022 04 30]]

⥅ related node [[2022 05 01]]

⥅ related node [[2022 05 02]]

⥅ related node [[2022 05 04]]

⥅ related node [[2022 05 05]]

⥅ related node [[2022 05 06]]

⥅ related node [[2022 05 07]]

⥅ related node [[2022 05 08]]

⥅ related node [[2022 05 09]]

⥅ related node [[2022 05 10]]

⥅ related node [[2022 05 11]]

⥅ related node [[2022 05 12]]

⥅ related node [[2022 05 13]]

⥅ related node [[2022 05 15]]

⥅ related node [[2022 05 16]]

⥅ related node [[2023 01 01]]

⥅ related node [[2023 01 02]]

⥅ related node [[2023 01 03]]

⥅ related node [[2023 01 04]]

⥅ related node [[2023 01 05]]

⥅ related node [[2023 01 06]]

⥅ related node [[2023 01 07]]

⥅ related node [[2023 01 09]]

⥅ related node [[2023 01 10]]

⥅ related node [[2023 01 11]]

⥅ related node [[2023 01 12]]

⥅ related node [[2023 01 13]]

⥅ related node [[2023 01 14]]

⥅ related node [[2023 01 15]]

⥅ related node [[2023 01 16]]

⥅ related node [[2023 01 17]]

⥅ related node [[2023 01 18]]

⥅ related node [[2023 01 20]]

⥅ related node [[2023 01 21]]

⥅ related node [[2023 01 22]]

⥅ related node [[2023 01 23]]

⥅ related node [[2023 01 25]]

⥅ related node [[2023 01 26]]

⥅ related node [[2023 01 27]]

⥅ related node [[2023 01 28]]

⥅ related node [[2023 01 29]]

⥅ related node [[2023 01 31]]

⥅ related node [[2023 02 02]]

⥅ related node [[2023 02 03]]

⥅ related node [[2023 02 04]]

⥅ related node [[2023 02 05]]

⥅ related node [[2023 02 06]]

⥅ related node [[2023 02 07]]

⥅ related node [[2023 02 08]]

⥅ related node [[2023 02 09]]

⥅ related node [[2023 02 10]]

⥅ related node [[2023 02 11]]

⥅ related node [[2023 02 12]]

⥅ related node [[2023 02 17]]

⥅ related node [[2023 02 18]]

⥅ related node [[2023 02 19]]

⥅ related node [[2023 02 20]]

⥅ related node [[2023 02 21]]

⥅ related node [[2023 02 23]]

⥅ related node [[2023 02 25]]

⥅ related node [[2023 02 26]]

⥅ related node [[2023 02 27]]

⥅ related node [[2023 02 28]]

⥅ related node [[2023 03 02]]

⥅ related node [[2023 03 03]]

⥅ related node [[2023 03 06]]

⥅ related node [[2023 03 07]]

⥅ related node [[2023 03 08]]

⥅ related node [[2023 03 09]]

⥅ related node [[2023 03 10]]

⥅ related node [[2023 03 11]]

⥅ related node [[2023 03 12]]

⥅ related node [[2023 03 13]]

⥅ related node [[2023 03 14]]

⥅ related node [[2023 03 15]]

⥅ related node [[2023 03 16]]

⥅ related node [[2023 03 17]]

⥅ related node [[2023 03 18]]

⥅ related node [[2023 03 19]]

⥅ related node [[2023 03 20]]

⥅ related node [[2023 03 21]]

⥅ related node [[2023 03 22]]

⥅ related node [[2023 03 23]]

⥅ related node [[2023 03 24]]

⥅ related node [[2023 03 27]]

⥅ related node [[2023 03 28]]

⥅ related node [[2023 03 29]]

⥅ related node [[2023 03 31]]

⥅ related node [[2023 04 01]]

⥅ related node [[2023 04 02]]

⥅ related node [[2023 04 03]]

⥅ related node [[2023 04 04]]

⥅ related node [[2023 04 06]]

⥅ related node [[2023 04 07]]

⥅ related node [[2023 04 08]]

⥅ related node [[2023 04 09]]

⥅ related node [[2023 04 10]]

⥅ related node [[2023 04 11]]

⥅ related node [[2023 04 12]]

⥅ related node [[2023 04 15]]

⥅ related node [[2023 04 16]]

⥅ related node [[2023 04 17]]

⥅ related node [[2023 04 21]]

⥅ related node [[2023 04 27]]

⥅ related node [[2023 04 28]]

⥅ related node [[2023 04 29]]

⥅ related node [[2023 04 30]]

⥅ related node [[2023 05 01]]

⥅ related node [[2023 05 02]]

⥅ related node [[2023 05 03]]

⥅ related node [[2023 05 04]]

⥅ related node [[2023 05 07]]

⥅ related node [[2023 05 08]]

⥅ related node [[2023 05 09]]

⥅ related node [[2023 05 10]]

⥅ related node [[2023 05 11]]

⥅ related node [[2023 05 13]]

⥅ related node [[2023 05 14]]

⥅ related node [[2023 05 15]]

⥅ related node [[2023 05 17]]

⥅ related node [[2023 05 19]]

⥅ related node [[2023 05 20]]

⥅ related node [[2023 05 22]]

⥅ related node [[2023 05 23]]

⥅ related node [[2023 05 25]]

⥅ related node [[2023 05 26]]

⥅ related node [[2023 05 27]]

⥅ related node [[2023 05 28]]

⥅ related node [[2023 05 30]]

⥅ related node [[2023 05 31]]

⥅ related node [[2023 06 01]]

⥅ related node [[2023 06 03]]

⥅ related node [[2023 06 04]]

⥅ related node [[2023 06 05]]

⥅ related node [[2023 06 07]]

⥅ related node [[2023 06 08]]

⥅ related node [[2023 06 10]]

⥅ related node [[2023 06 11]]

⥅ related node [[2023 06 13]]

⥅ related node [[2023 06 16]]

⥅ related node [[2023 06 17]]

⥅ related node [[2023 06 20]]

⥅ related node [[2023 06 22]]

⥅ related node [[2023 06 23]]

⥅ related node [[2023 06 24]]

⥅ related node [[2023 06 25]]

⥅ related node [[2023 06 26]]

⥅ related node [[2023 06 27]]

⥅ related node [[2023 06 30]]

⥅ related node [[2023 07 04]]

⥅ related node [[2023 07 05]]

⥅ related node [[2023 07 06]]

⥅ related node [[2023 07 08]]

⥅ related node [[2023 07 12]]

⥅ related node [[2023 07 14]]

⥅ related node [[2023 07 15]]

⥅ related node [[2023 07 16]]

⥅ related node [[2023 07 17]]

⥅ related node [[2023 07 18]]

⥅ related node [[2023 07 19]]

⥅ related node [[2023 07 20]]

⥅ related node [[2023 07 22]]

⥅ related node [[2023 07 23]]

⥅ related node [[2023 07 24]]

⥅ related node [[2023 07 25]]

⥅ related node [[2023 07 26]]

⥅ related node [[2023 07 29]]

⥅ related node [[2023 07 31]]

⥅ related node [[2023 08 01]]

⥅ related node [[2023 08 02]]

⥅ related node [[2023 08 03]]

⥅ related node [[2023 08 05]]

⥅ related node [[2023 08 06]]

⥅ related node [[2023 08 07]]

⥅ related node [[2023 08 09]]

⥅ related node [[2023 08 10]]

⥅ related node [[2023 08 12]]

⥅ related node [[2023 08 13]]

⥅ related node [[2023 08 14]]

⥅ related node [[2023 08 16]]

⥅ related node [[2023 08 17]]

⥅ related node [[2023 08 18]]

⥅ related node [[2023 08 19]]

⥅ related node [[2023 08 20]]

⥅ related node [[2023 08 21]]

⥅ related node [[2023 08 22]]

⥅ related node [[2023 08 23]]

⥅ related node [[2023 08 24]]

⥅ related node [[2023 08 26]]

⥅ related node [[2023 08 28]]

⥅ related node [[2023 08 29]]

⥅ related node [[2023 08 30]]

⥅ related node [[2023 08 31]]

⥅ related node [[2023 09 01]]

⥅ related node [[2023 09 02]]

⥅ related node [[2023 09 03]]

⥅ related node [[2023 09 04]]

⥅ related node [[2023 09 07]]

⥅ related node [[2023 09 09]]

⥅ related node [[2023 09 10]]

⥅ related node [[2023 09 11]]

⥅ related node [[2023 09 15]]

⥅ related node [[2023 09 17]]

⥅ related node [[2023 09 18]]

⥅ related node [[2023 09 20]]

⥅ related node [[2023 09 21]]

⥅ related node [[2023 09 23]]

⥅ related node [[2023 09 24]]

⥅ related node [[2023 09 25]]

⥅ related node [[2023 09 26]]

⥅ related node [[2023 09 27]]

⥅ related node [[2023 09 29]]

⥅ related node [[2023 09 30]]

⥅ related node [[2023 10 01]]

⥅ related node [[2023 10 02]]

⥅ related node [[2023 10 03]]

⥅ related node [[2023 10 04]]

⥅ related node [[2023 10 05]]

⥅ related node [[2023 10 06]]

⥅ related node [[2023 10 07]]

⥅ related node [[2023 10 09]]

⥅ related node [[2023 10 11]]

⥅ related node [[2023 10 14]]

⥅ related node [[2023 10 15]]

⥅ related node [[2023 10 16]]

⥅ related node [[2023 10 17]]

⥅ related node [[2023 10 19]]

⥅ related node [[2023 10 21]]

⥅ related node [[2023 10 22]]

⥅ related node [[2023 11 02]]

⥅ related node [[2023 11 05]]

⥅ related node [[2023 11 18]]

⥅ related node [[2023 11 19]]

⥅ related node [[2023 11 20]]

⥅ related node [[2023 11 21]]

⥅ related node [[2023 11 24]]

⥅ related node [[2023 11 25]]

⥅ related node [[2023 11 26]]

⥅ related node [[2023 11 28]]

⥅ related node [[2023 11 29]]

⥅ related node [[2023 11 30]]

⥅ related node [[2023 12 01]]

⥅ related node [[2023 12 02]]

⥅ related node [[2023 12 03]]

⥅ related node [[2023 12 04]]

⥅ related node [[2023 12 05]]

⥅ related node [[2023 12 06]]

⥅ related node [[2023 12 07]]

⥅ related node [[2023 12 08]]

⥅ related node [[2023 12 09]]

⥅ related node [[2023 12 11]]

⥅ related node [[2023 12 11_backup_277894]]

⥅ related node [[2023 12 11_base_277894]]

⥅ related node [[2023 12 11_local_277894]]

⥅ related node [[2023 12 11_remote_277894]]

⥅ related node [[2023 12 12]]

⥅ related node [[2023 12 14]]

⥅ related node [[2023 12 15]]

⥅ related node [[2023 12 16]]

⥅ related node [[2023 12 18]]

⥅ related node [[2023 12 20]]

⥅ related node [[2023 12 21]]

⥅ related node [[2023 12 22]]

⥅ related node [[2023 12 23]]

⥅ related node [[2023 12 25]]

⥅ related node [[2023 12 26]]

⥅ related node [[2023 12 27]]

⥅ related node [[2023 12 29]]

⥅ related node [[2023 12 30]]

⥅ related node [[2023 12 31]]

⥅ related node [[2024 01 02]]

⥅ related node [[2024 01 03]]

⥅ related node [[2024 01 04]]

⥅ related node [[2024 01 05]]

⥅ related node [[2024 01 07]]

⥅ related node [[2024 01 09]]

⥅ related node [[2024 01 13]]

⥅ related node [[2024 01 14]]

⥅ related node [[2024 01 15]]

⥅ related node [[2024 01 16]]

⥅ related node [[2024 01 17]]

⥅ related node [[2024 01 20]]

⥅ related node [[2024 01 21]]

⥅ related node [[2024 01 23]]

⥅ related node [[2024 01 25]]

⥅ related node [[2024 01 27]]

⥅ related node [[2024 01 30]]

⥅ related node [[2024 01 31]]

⥅ related node [[2024 02 01]]

⥅ related node [[2024 02 03]]

⥅ related node [[2024 02 04]]

⥅ related node [[2024 02 05]]

⥅ related node [[2024 02 06]]

⥅ related node [[2024 02 07]]

⥅ related node [[2024 02 10]]

⥅ related node [[2024 02 12]]

⥅ related node [[2024 02 13]]

⥅ related node [[2024 02 15]]

⥅ related node [[2024 02 16]]

⥅ related node [[2024 02 17]]

⥅ related node [[2024 02 20]]

⥅ related node [[2024 02 23]]

⥅ related node [[2024 02 26]]

⥅ related node [[2024 03 01]]

⥅ related node [[2024 03 03]]

⥅ related node [[2024 03 04]]

⥅ related node [[2024 03 05]]

⥅ related node [[2024 03 06]]

⥅ related node [[2024 03 07]]

⥅ related node [[2024 03 10]]

⥅ related node [[2024 03 11]]

⥅ related node [[2024 03 15]]

⥅ related node [[2024 03 16]]

⥅ related node [[2024 03 18]]

⥅ related node [[2024 03 20]]

⥅ related node [[2024 03 26]]

⥅ related node [[2024 03 28]]

⥅ related node [[2024 04 01]]

⥅ related node [[2024 04 05]]

⥅ related node [[2024 04 11]]

⥅ related node [[2024 04 18]]

⥅ related node [[2024 04 27]]

⥅ related node [[2024 04 30]]

⥅ related node [[2024 05 03]]

⥅ related node [[2024 05 07]]

⥅ related node [[2024 05 08]]

⥅ related node [[2024 05 09]]

⥅ related node [[2024 05 11]]

⥅ related node [[2024 05 12]]

⥅ related node [[2024 05 13]]

⥅ related node [[2024 05 15]]

⥅ related node [[2024 05 16]]

⥅ related node [[2024 05 21]]

⥅ related node [[2024 05 24]]

⥅ related node [[2024 05 27]]

⥅ related node [[2024 05 29]]

⥅ related node [[2024 05 31]]

⥅ related node [[2024 06 01]]

⥅ related node [[2024 06 03]]

⥅ related node [[2024 06 04]]

⥅ related node [[2024 06 12]]

⥅ related node [[2024 06 15]]

⥅ related node [[2024 06 18]]

⥅ related node [[2024 06 19]]

⥅ related node [[2024 06 24]]

⥅ related node [[2024 06 26]]

⥅ related node [[2024 06 28]]

⥅ related node [[2024 06 29]]

⥅ related node [[2024 07 02]]

⥅ related node [[2024 07 03]]

⥅ related node [[2024 07 08]]

⥅ related node [[2024 07 09]]

⥅ related node [[2024 07 11]]

⥅ related node [[2024 07 19]]

⥅ related node [[2024 07 20 conflicted 1721431903785]]

⥅ related node [[2024 07 27]]

⥅ related node [[2024 07 30]]

⥅ related node [[2024 08 02]]

⥅ related node [[2024 08 04]]

⥅ related node [[2024 08 05]]

⥅ related node [[2024 08 06]]

⥅ related node [[2025 01 14]]

⥅ related node [[bill flancian]]

⥅ related node [[2024 02 25]]

⥅ related node [[2024 03 02]]

⥅ related node [[2024 03 12]]

⥅ related node [[2024 03 17]]

⥅ related node [[2024 04 14]]

⥅ related node [[2024 04 15]]

⥅ related node [[2024 04 29]]

⥅ related node [[2024 05 14]]

⥅ related node [[2024 05 17]]

⥅ related node [[2024 06 06]]

⥅ related node [[2024 06 09]]

⥅ related node [[journalctl]]

⥅ related node [[journals]]

⥅ related node [[joviality]]

⥅ related node [[js subnodes]]

⥅ related node [[json ld]]

⥅ related node [[jsonlz4]]

⥅ related node [[juan carlos onetti]]

⥅ related node [[juan jose fernandez]]

⥅ related node [[juan josé saer]]

⥅ related node [[juan rafael]]

⥅ related node [[juan sasturain]]

⥅ related node [[juanra31a]]

⥅ related node [[jud brewer]]

⥅ related node [[juegos geográficos]]

⥅ related node [[julia fox]]

⥅ related node [[julia galef]]

⥅ related node [[julia serano]]

⥅ related node [[julian of norwich]]

⥅ related node [[juliana barwick]]

⥅ related node [[julio cortázar]]

⥅ related node [[julio jcortázar]]

⥅ related node [[jump]]

⥅ related node [[jumpsuit chic]]

⥅ related node [[jungwon]]

⥅ related node [[juntos venceremos a moloch]]

⥅ related node [[juntos]]

⥅ related node [[junyu zhan]]

⥅ related node [[just do it]]

⥅ related node [[justine tunney]]

⥅ related node [[jwz]]

⥅ related node [[jz feedback]]

⥅ related node [[jz]]

⥅ related node [[kaleido]]

⥅ related node [[kalkbreite]]

⥅ related node [[kamairicha]]

⥅ related node [[kanban]]

⥅ related node [[kanjun]]

⥅ related node [[karl marx technofuturist]]

⥅ related node [[karl marx]]

⥅ related node [[karlicoss flancian]]

⥅ related node [[karlicoss]]

⥅ related node [[karthikk vijay]]

⥅ related node [[kartik agaram]]

⥅ related node [[kartonsammlung]]

⥅ related node [[kasina]]

⥅ related node [[kasparov vs the world]]

⥅ related node [[kasra kaley]]

⥅ related node [[kasra]]

⥅ related node [[katamari damacy]]

⥅ related node [[kate nv]]

⥅ related node [[kbin]]

⥅ related node [[keepassxc]]

⥅ related node [[keith johnstone]]

⥅ related node [[ken wilber]]

⥅ related node [[kenzo tange]]

⥅ related node [[kept]]

⥅ related node [[kepta]]

⥅ related node [[key lime pie]]

⥅ related node [[keybase]]

⥅ related node [[keyboard wiki]]

⥅ related node [[keyoxide]]

⥅ related node [[keyword]]

⥅ related node [[kfaraday]]

⥅ related node [[kgbicheno]]

⥅ related node [[kibble]]

⥅ related node [[kill wayland]]

⥅ related node [[killing rage]]

⥅ related node [[kind revolution]]

⥅ related node [[kind hearted]]

⥅ related node [[kindle]]

⥅ related node [[kindly]]

⥅ related node [[kipple]]

⥅ related node [[kirby ferguson]]

⥅ related node [[kitty]]

⥅ related node [[klaus lackner]]

⥅ related node [[klaus]]

⥅ related node [[km]]

⥅ related node [[kneaver]]

⥅ related node [[knight first amendment institute]]

⥅ related node [[knots]]

⥅ related node [[knovigator]]

⥅ related node [[know me]]

⥅ related node [[know your amphetamines]]

⥅ related node [[know your amphethamines]]

⥅ related node [[know]]

⥅ related node [[knowledge bases]]

⥅ related node [[knowledge common]]

⥅ related node [[knowledge commons]]

⥅ related node [[knowledge federation]]

⥅ related node [[knowledge futures group]]

⥅ related node [[knowledge garden overview]]

⥅ related node [[knowledge graphs and indylab]]

⥅ related node [[knowledge graphs]]

⥅ related node [[knowledge management applications]]

⥅ related node [[knowledge metaverse]]

⥅ related node [[knowledge roots]]

⥅ related node [[knowledge]]

⥅ related node [[known agoras]]

⥅ related node [[koa]]

⥅ related node [[koos looijesteijn]]

⥅ related node [[kopiko]]

⥅ related node [[kosmik]]

⥅ related node [[kota ikenaga]]

⥅ related node [[kozmonavt]]

⥅ related node [[kraftwerk 1]]

⥅ related node [[kraftwerk1]]

⥅ related node [[krakauer]]

⥅ related node [[kris kaminski]]

⥅ related node [[kris kaminsky]]

⥅ related node [[kris]]

⥅ related node [[ksitigarbha]]

⥅ related node [[kubectl]]

⥅ related node [[kuprin]]

⥅ related node [[kurdish]]

⥅ related node [[kurt vonnegut]]

⥅ related node [[kvistgaard]]

⥅ related node [[kyosaku jon]]

⥅ related node [[l allegro il penseroso ed il moderato]]

⥅ related node [[l effondrement]]

⥅ related node [[l a]]

⥅ related node [[l ]]

⥅ related node [[la censura de buddha]]

⥅ related node [[la jaula de oro]]

⥅ related node [[la roche posay]]

⥅ related node [[la vida breve]]

⥅ related node [[laarc io]]

⥅ related node [[labyrinths]]

⥅ related node [[labör]]

⥅ related node [[lacan]]

⥅ related node [[lacaton and vassal]]

⥅ related node [[lace of country streets]]

⥅ related node [[ladcia]]

⥅ related node [[ladee]]

⥅ related node [[lady burup]]

⥅ related node [[lady murasaki]]

⥅ related node [[ladybird]]

⥅ related node [[lag]]

⥅ related node [[lago atitlán]]

⥅ related node [[laiki agora]]

⥅ related node [[lake atitlán]]

⥅ related node [[lama jigme rinpoche]]

⥅ related node [[lambda calculus]]

⥅ related node [[lambertian]]

⥅ related node [[land of silence and darkness]]

⥅ related node [[landauer limit]]

⥅ related node [[langston hughes]]

⥅ related node [[language games]]

⥅ related node [[language learning with netflix]]

⥅ related node [[laraaji]]

⥅ related node [[large scope]]

⥅ related node [[las aventuras de lurup y burupardo]]

⥅ related node [[las jaras qué jaras]]

⥅ related node [[las jaras]]

⥅ related node [[las obreras]]

⥅ related node [[las pelotas llenas]]

⥅ related node [[last will]]

⥅ related node [[late stage capitalism]]

⥅ related node [[latent compass]]

⥅ related node [[later]]

⥅ related node [[latest]]

⥅ related node [[laundry]]

⥅ related node [[laura waters]]

⥅ related node [[lausanne]]

⥅ related node [[lcdf]]

⥅ related node [[leah houston]]

⥅ related node [[learn datalog today]]

⥅ related node [[learning rust]]

⥅ related node [[learning to learn]]

⥅ related node [[learning]]

⥅ related node [[leave]]

⥅ related node [[leaves]]

⥅ related node [[lecun]]

⥅ related node [[lee perry]]

⥅ related node [[left market anarchist]]

⥅ related node [[lehoczkyescobar]]

⥅ related node [[leibniz]]

⥅ related node [[leigh brasington]]

⥅ related node [[lemmy]]

⥅ related node [[lenguaje universal]]

⥅ related node [[lenovo p14]]

⥅ related node [[leon trotsky]]

⥅ related node [[lervag]]

⥅ related node [[less wrong]]

⥅ related node [[lesswrong]]

⥅ related node [[lester brown]]

⥅ related node [[let forever be]]

⥅ related node [[let me know]]

⥅ related node [[let me show you the shape of my heart]]

⥅ related node [[let me show you]]

⥅ related node [[let us be one]]

⥅ related node [[let us do loving kindness]]

⥅ related node [[let us go together into the sky]]

⥅ related node [[letter from birmingham jail]]

⥅ related node [[letter from the founders]]

⥅ related node [[letter to angelina]]

⥅ related node [[letter wiki]]

⥅ related node [[letters]]

⥅ related node [[levadas]]

⥅ related node [[levenshtein distance]]

⥅ related node [[levi hart]]

⥅ related node [[lex fridman]]

⥅ related node [[lex maria]]

⥅ related node [[lex]]

⥅ related node [[lgtm]]

⥅ related node [[liberal internationalism]]

⥅ related node [[quick note]]

⥅ related node [[maintenance]]

⥅ related node [[template index]]

⥅ related node [[page]]

⥅ related node [[task]]

⥅ related node [[template]]

⥅ related node [[quick notes]]

⥅ related node [[each directive]]

⥅ related node [[frontmatter]]

⥅ related node [[h1]]

⥅ related node [[h2]]

⥅ related node [[h3]]

⥅ related node [[h4]]

⥅ related node [[hr]]

⥅ related node [[if directive]]

⥅ related node [[if else directive]]

⥅ related node [[let directive]]

⥅ related node [[note admonition]]

⥅ related node [[query]]

⥅ related node [[table]]

⥅ related node [[today]]

⥅ related node [[tomorrow]]

⥅ related node [[warning admonition]]

⥅ related node [[federated template copy]]

⥅ related node [[linked mentions]]

⥅ related node [[linked tasks]]

⥅ related node [[table of contents]]

⥅ related node [[tagged tasks]]

⥅ related node [[daily note]]

⥅ related node [[weekly note]]

⥅ related node [[libres dignos vivos]]

⥅ related node [[libretexts]]

⥅ related node [[libros para regalar]]

⥅ related node [[liege]]

⥅ related node [[life]]

⥅ related node [[lifeofc]]

⥅ related node [[ligeti]]

⥅ related node [[light matter interaction in open cavities with dielectric stacks]]

⥅ related node [[light]]

⥅ related node [[lightning talks]]

⥅ related node [[lightone]]

⥅ related node [[lights]]

⥅ related node [[liguria todo]]

⥅ related node [[liguria]]

⥅ related node [[like an arrow]]

⥅ related node [[like]]

⥅ related node [[liked]]

⥅ related node [[likes]]

⥅ related node [[liminal warmth]]

⥅ related node [[liminal]]

⥅ related node [[limit]]

⥅ related node [[lin ostrom]]

⥅ related node [[lindy effect]]

⥅ related node [[lingua franca]]

⥅ related node [[linguistic example sentences]]

⥅ related node [[link and think]]

⥅ related node [[link it as you go along]]

⥅ related node [[link rot]]

⥅ related node [[link]]

⥅ related node [[linkify2]]

⥅ related node [[links]]

⥅ related node [[linksspringer]]

⥅ related node [[linus lee]]

⥅ related node [[linus torvalds]]

⥅ related node [[lique]]

⥅ related node [[liquid democracy]]

⥅ related node [[lisp]]

⥅ related node [[list of ideas]]

⥅ related node [[list of lists of lists]]

⥅ related node [[list of lists]]

⥅ related node [[list of matrix servers]]

⥅ related node [[list of twitter alternatives]]

⥅ related node [[list]]

⥅ related node [[lista]]

⥅ related node [[listen]]

⥅ related node [[lists of lists of lists]]

⥅ related node [[lists of lists]]

⥅ related node [[literal]]

⥅ related node [[literature]]

⥅ related node [[live noding]]

⥅ related node [[live redesign]]

⥅ related node [[live tooting]]

⥅ related node [[live]]

⥅ related node [[living in the future]]

⥅ related node [[living utopia]]

⥅ related node [[living]]

⥅ related node [[llm]]

⥅ related node [[lm studio]]

⥅ related node [[loas a buda]]

⥅ related node [[loas]]

⥅ related node [[lobste rs]]

⥅ related node [[locus of points]]

⥅ related node [[lofi girl]]

⥅ related node [[logarithmic integral function]]

⥅ related node [[logic]]

⥅ related node [[login]]

⥅ related node [[logitech camera too dark on raspberry pi]]

⥅ related node [[logseq bugs]]

⥅ related node [[logseq document mode]]

⥅ related node [[logseq marketplace]]

⥅ related node [[lonesome no more]]

⥅ related node [[long weekend]]

⥅ related node [[longer stoa ids]]

⥅ related node [[longevity]]

⥅ related node [[longform]]

⥅ related node [[longomai]]

⥅ related node [[loom]]

⥅ related node [[loomio]]

⥅ related node [[lorand]]

⥅ related node [[lord enki]]

⥅ related node [[los besos]]

⥅ related node [[los bienes comunes del conocimiento]]

⥅ related node [[los oficios terrestres]]

⥅ related node [[los olimareños]]

⥅ related node [[losses]]

⥅ related node [[lost and found]]

⥅ related node [[lotus sutra]]

⥅ related node [[love kindly]]

⥅ related node [[love will tear us apart]]

⥅ related node [[love]]

⥅ related node [[lovelace]]

⥅ related node [[loving kindness revolution]]

⥅ related node [[loving kindness]]

⥅ related node [[lower back pain]]

⥅ related node [[lowry doc]]

⥅ related node [[lowry]]

⥅ related node [[loyalty]]

⥅ related node [[loyd blankenship]]

⥅ related node [[lp]]

⥅ related node [[lp1]]

⥅ related node [[lrhodes]]

⥅ related node [[luca landucci]]

⥅ related node [[lucasarts]]

⥅ related node [[luciana]]

⥅ related node [[lucid innocence]]

⥅ related node [[lucid]]

⥅ related node [[lucidrains]]

⥅ related node [[lucretius]]

⥅ related node [[luis gallardo]]

⥅ related node [[luminosity]]

⥅ related node [[luxury space communism]]

⥅ related node [[lw]]

⥅ related node [[lxml]]

⥅ related node [[lyn hejinian]]

⥅ related node [[lyra]]

⥅ related node [[lägern]]

⥅ related node [[m prime]]

⥅ related node [[m b ]]

⥅ related node [[mabinogion]]

⥅ related node [[macedonio fernandez]]

⥅ related node [[macedonio fernández]]

⥅ related node [[macedonio]]

⥅ related node [[macevedo]]

⥅ related node [[macroecology]]

⥅ related node [[madness rack and honey]]

⥅ related node [[madrid 2022]]

⥅ related node [[magdalene]]

⥅ related node [[maggie appleton]]

⥅ related node [[magic mushrooms]]

⥅ related node [[magic]]

⥅ related node [[magma collective]]

⥅ related node [[magnets]]

⥅ related node [[maharashtra]]

⥅ related node [[mailing list]]

⥅ related node [[main plan]]

⥅ related node [[maintain my body]]

⥅ related node [[maintain]]

⥅ related node [[maintainer]]

⥅ related node [[maintainers]]

⥅ related node [[maitreya ai]]

⥅ related node [[maitreya flowing]]

⥅ related node [[maitreya]]

⥅ related node [[majusri]]

⥅ related node [[make included gardens more visible]]

⥅ related node [[make up links that dont exist yet]]

⥅ related node [[makememe]]

⥅ related node [[makhno]]

⥅ related node [[mako]]

⥅ related node [[malazan]]

⥅ related node [[malcolm x]]

⥅ related node [[male]]

⥅ related node [[maleza]]

⥅ related node [[malfatti]]

⥅ related node [[mallorca]]

⥅ related node [[malovich]]

⥅ related node [[mamá]]

⥅ related node [[man from yemen]]

⥅ related node [[man in the middle]]

⥅ related node [[mandarin]]

⥅ related node [[mangled in transit conflicted 0]]

⥅ related node [[mangled in transit]]

⥅ related node [[manifestos]]

⥅ related node [[manifold with self attention]]

⥅ related node [[manipadme]]

⥅ related node [[manipulation of democracy]]

⥅ related node [[manjushri]]

⥅ related node [[mantequillas]]

⥅ related node [[mantras]]

⥅ related node [[many flancians follow the eightfold path]]

⥅ related node [[many nines]]

⥅ related node [[many universes]]

⥅ related node [[map of flancia]]

⥅ related node [[map of the fediverse]]

⥅ related node [[map of the internet]]

⥅ related node [[mapping the fediverse]]

⥅ related node [[maps]]

⥅ related node [[mapy]]

⥅ related node [[maqna]]

⥅ related node [[maranasati]]

⥅ related node [[marc antoine parent]]

⥅ related node [[marcelo tinelli]]

⥅ related node [[marcuse]]

⥅ related node [[margaret warren]]

⥅ related node [[marginal syllabus]]

⥅ related node [[marie cecilia smith]]

⥅ related node [[marina garcés]]

⥅ related node [[marinara]]

⥅ related node [[mark graham]]

⥅ related node [[markdown links]]

⥅ related node [[markdown on git]]

⥅ related node [[markdown]]

⥅ related node [[marko]]

⥅ related node [[markov blankets]]

⥅ related node [[marquesa de burupina]]

⥅ related node [[marras]]

⥅ related node [[marroni cake]]

⥅ related node [[mars]]

⥅ related node [[marshall mcluhan]]

⥅ related node [[martin gardner]]

⥅ related node [[martin luther king]]

⥅ related node [[martin paul eve]]

⥅ related node [[marx]]

⥅ related node [[marxism]]

⥅ related node [[marxist thinkers]]

⥅ related node [[mary lattimore]]

⥅ related node [[masa de empanadas]]

⥅ related node [[masa de tarta]]

⥅ related node [[maslow]]

⥅ related node [[massive wiki]]

⥅ related node [[master plan]]

⥅ related node [[mastering the core teachings of the buddha]]

⥅ related node [[mastery]]

⥅ related node [[mastodon bot]]

⥅ related node [[mastodon clients]]

⥅ related node [[mastodon forks]]

⥅ related node [[mastodon instance]]

⥅ related node [[mastodon instances]]

⥅ related node [[mastodon py]]

⥅ related node [[mate]]

⥅ related node [[mathematical logic]]

⥅ related node [[mathematical models]]

⥅ related node [[mathematical universe hypothesis]]

⥅ related node [[mathematical universe]]

⥅ related node [[mathematician]]

⥅ related node [[mathew lowry]]

⥅ related node [[mathewlowry]]

⥅ related node [[mathieudutour]]

⥅ related node [[mathilde sanders]]

⥅ related node [[mathjax]]

⥅ related node [[matriarchies]]

⥅ related node [[matrix activitypub bridge]]

⥅ related node [[matrix agora]]

⥅ related node [[matrix bot]]

⥅ related node [[matrix server list]]

⥅ related node [[matrix servers]]

⥅ related node [[matrix]]

⥅ related node [[matt parker]]

⥅ related node [[matterbridge]]

⥅ related node [[mattermost]]

⥅ related node [[maubot]]

⥅ related node [[max stauffer]]

⥅ related node [[max tegmark]]

⥅ related node [[maximally inclusive]]

⥅ related node [[maya]]

⥅ related node [[maybe also]]

⥅ related node [[maybe musk will wake up]]

⥅ related node [[maybe we will slay moloch tonight]]

⥅ related node [[maybe]]

⥅ related node [[maybes]]

⥅ related node [[mayel de borniol]]

⥅ related node [[mayel space]]

⥅ related node [[mayfer]]

⥅ related node [[mañana]]

⥅ related node [[mctb]]

⥅ related node [[md img paste]]

⥅ related node [[mdbook]]

⥅ related node [[me high cheek sent me high]]

⥅ related node [[me tiene las pelotas llenas]]

⥅ related node [[me tienen las pelotas llenas]]

⥅ related node [[me]]

⥅ related node [[meaning supplies]]

⥅ related node [[meaningness]]

⥅ related node [[meca]]

⥅ related node [[mechanical monk]]

⥅ related node [[media infra summit]]

⥅ related node [[mediawiki recipe]]

⥅ related node [[meditate now]]

⥅ related node [[meditate]]

⥅ related node [[meditation number one]]

⥅ related node [[meditation technique]]

⥅ related node [[meditation]]

⥅ related node [[meditations on moloch]]

⥅ related node [[meditations on procrastination]]

⥅ related node [[meditations]]

⥅ related node [[meditationstuff]]

⥅ related node [[mediterranean garden]]

⥅ related node [[medito]]

⥅ related node [[meet coop evolution]]

⥅ related node [[meet partitioning]]

⥅ related node [[meet partitionining]]

⥅ related node [[mega]]

⥅ related node [[megacoops]]

⥅ related node [[mehr als wohnen]]

⥅ related node [[mehralswohnen]]

⥅ related node [[meilisearch]]

⥅ related node [[meitei]]

⥅ related node [[melancholy]]

⥅ related node [[melanocarpa]]

⥅ related node [[melog]]

⥅ related node [[member]]

⥅ related node [[meme generator]]

⥅ related node [[meme traditions]]

⥅ related node [[memedelperro bot]]

⥅ related node [[memedelperro]]

⥅ related node [[memedit]]

⥅ related node [[memento protocol]]

⥅ related node [[memeplex]]

⥅ related node [[memex]]

⥅ related node [[memo]]

⥅ related node [[memoria]]

⥅ related node [[memories of green]]

⥅ related node [[mencius goldbug]]

⥅ related node [[mending wall]]

⥅ related node [[mental context]]

⥅ related node [[mental contexts]]

⥅ related node [[mental nodes]]

⥅ related node [[mental state]]

⥅ related node [[mentalnodes]]

⥅ related node [[mercury fountain]]

⥅ related node [[merge vs rebase]]

⥅ related node [[merge]]

⥅ related node [[meritocracy]]

⥅ related node [[merseilles]]

⥅ related node [[mersenne primes]]

⥅ related node [[merveilles]]

⥅ related node [[mesh]]

⥅ related node [[meshachthomas]]

⥅ related node [[meta semantic markers]]

⥅ related node [[metabolist]]

⥅ related node [[metadreamer]]

⥅ related node [[metal bands]]

⥅ related node [[metam0nkey]]

⥅ related node [[metamagical themas]]

⥅ related node [[metametrician]]

⥅ related node [[metamitya]]

⥅ related node [[metamuse]]

⥅ related node [[metaphor]]

⥅ related node [[metasj flancian]]

⥅ related node [[metasj]]

⥅ related node [[metaverse interop]]

⥅ related node [[metaverse]]

⥅ related node [[meteora]]

⥅ related node [[method of loci]]

⥅ related node [[mettarevolution]]

⥅ related node [[mettarrhiza]]

⥅ related node [[mettā]]

⥅ related node [[mexico city]]

⥅ related node [[michael aird]]

⥅ related node [[michael d tubbs]]

⥅ related node [[michael graham]]

⥅ related node [[michael ocean]]

⥅ related node [[michael taft]]

⥅ related node [[michael tubbs]]

⥅ related node [[michaeldgrahams]]

⥅ related node [[michel de montaigne]]

⥅ related node [[michel foucault]]

⥅ related node [[michelson interferometer]]

⥅ related node [[micro poem]]

⥅ related node [[micro pub]]

⥅ related node [[microsolidarity]]

⥅ related node [[mid career greatest hits]]

⥅ related node [[middle way]]

⥅ related node [[midi]]

⥅ related node [[midjourney]]

⥅ related node [[midnight in a perfect world]]

⥅ related node [[midnight run]]

⥅ related node [[miguel hernández]]

⥅ related node [[miguel marcos martinez]]

⥅ related node [[mihaly csikszentmihalyi]]

⥅ related node [[mihály csíkszentmihályi]]

⥅ related node [[mikaeln]]

⥅ related node [[mike caulfield]]

⥅ related node [[mike elias]]

⥅ related node [[mimesis]]

⥅ related node [[mind merge]]

⥅ related node [[mind over chatter]]

⥅ related node [[mind palace]]

⥅ related node [[mind uploading and the revolution]]

⥅ related node [[mind]]

⥅ related node [[mindfulness bell]]

⥅ related node [[minetest]]

⥅ related node [[minigolf hard]]

⥅ related node [[minimum effort constructive action]]

⥅ related node [[miningcity]]

⥅ related node [[miro]]

⥅ related node [[mirror]]

⥅ related node [[missing devices]]

⥅ related node [[missing semester]]

⥅ related node [[misskey]]

⥅ related node [[mistral]]

⥅ related node [[mithril]]

⥅ related node [[mitm]]

⥅ related node [[ml5 js]]

⥅ related node [[mmacevedo]]

⥅ related node [[mmalign]]

⥅ related node [[mmanifesto]]

⥅ related node [[mmmalign]]

⥅ related node [[mnemonic]]

⥅ related node [[mnemosyne]]

⥅ related node [[moa git]]

⥅ related node [[moa is broken]]

⥅ related node [[moa matrix]]

⥅ related node [[moa polls]]

⥅ related node [[moa tasks]]

⥅ related node [[moa]]

⥅ related node [[mob mentality]]

⥅ related node [[model of the world]]

⥅ related node [[moderation]]

⥅ related node [[moena zeller]]

⥅ related node [[mogrify]]

⥅ related node [[mohammed aldhari]]

⥅ related node [[mohammed plan]]

⥅ related node [[mohammed]]

⥅ related node [[molchat doma]]

⥅ related node [[moleskine]]

⥅ related node [[molly mielke]]

⥅ related node [[moloch s bargain]]

⥅ related node [[moloch]]

⥅ related node [[monday]]

⥅ related node [[mondegreen]]

⥅ related node [[mondegreens]]

⥅ related node [[mondragon]]

⥅ related node [[money free world]]

⥅ related node [[monk]]

⥅ related node [[monkey island]]

⥅ related node [[monks in space]]

⥅ related node [[monocle]]

⥅ related node [[monthly]]

⥅ related node [[moomin]]

⥅ related node [[moon ribas]]

⥅ related node [[moondog]]

⥅ related node [[moral principles]]

⥅ related node [[more]]

⥅ related node [[mountains]]

⥅ related node [[move 9]]

⥅ related node [[move]]

⥅ related node [[movebank]]

⥅ related node [[movie]]

⥅ related node [[movies]]

⥅ related node [[mozart]]

⥅ related node [[mozilla hubs]]

⥅ related node [[mp]]

⥅ related node [[mpd]]

⥅ related node [[mpdominguez]]

⥅ related node [[mr green]]

⥅ related node [[muhammad ﷺ]]

⥅ related node [[muhammad]]

⥅ related node [[mujaddara]]

⥅ related node [[multiplayer roam]]

⥅ related node [[multiplicity]]

⥅ related node [[multitool]]

⥅ related node [[multiverse]]

⥅ related node [[municipalism]]

⥅ related node [[municipalist]]

⥅ related node [[murat]]

⥅ related node [[murray bookchin]]

⥅ related node [[murray]]

⥅ related node [[murs a pêches]]

⥅ related node [[muscle wiki]]

⥅ related node [[muse]]

⥅ related node [[museum für gestaltung zürich]]

⥅ related node [[music for animals]]

⥅ related node [[music for hacking]]

⥅ related node [[music for plants]]

⥅ related node [[music for programming]]

⥅ related node [[music hackspace]]

⥅ related node [[musikino]]

⥅ related node [[musk]]

⥅ related node [[mvp]]

⥅ related node [[mwiik]]

⥅ related node [[my dns]]

⥅ related node [[my favorite integer sequences]]

⥅ related node [[my favourite things]]

⥅ related node [[my flancia]]

⥅ related node [[my goal in life]]

⥅ related node [[my heart]]

⥅ related node [[my mind]]

⥅ related node [[mycoformat]]

⥅ related node [[mycomarkup]]

⥅ related node [[mycorrhiza]]

⥅ related node [[mycoverse]]

⥅ related node [[mycroft ai]]

⥅ related node [[mycroft]]

⥅ related node [[mykola]]

⥅ related node [[mymind]]

⥅ related node [[mynoise]]

⥅ related node [[myself]]

⥅ related node [[mystic computer club]]

⥅ related node [[n 1]]

⥅ related node [[n space]]

⥅ related node [[n26]]

⥅ related node [[nadia eghbal]]

⥅ related node [[nadia]]

⥅ related node [[nadie es la patria]]

⥅ related node [[nagarjuna]]

⥅ related node [[name place animal thing]]

⥅ related node [[namedgraph]]

⥅ related node [[namepresumably]]

⥅ related node [[nano page]]

⥅ related node [[naranja]]

⥅ related node [[naropa university]]

⥅ related node [[narrative]]

⥅ related node [[nathan schneider]]

⥅ related node [[nathanael gould]]

⥅ related node [[nationhstates]]

⥅ related node [[nationstates]]

⥅ related node [[nature of existence]]

⥅ related node [[naval]]

⥅ related node [[naxos]]

⥅ related node [[nayafia]]

⥅ related node [[nazi]]

⥅ related node [[nazis]]

⥅ related node [[nbhdlady]]

⥅ related node [[nccr survey]]

⥅ related node [[nccr]]

⥅ related node [[neal stephenson]]

⥅ related node [[neauoire]]

⥅ related node [[necklace of community projects]]

⥅ related node [[neil experiments]]

⥅ related node [[neil harbisson]]

⥅ related node [[neil sloane]]

⥅ related node [[neil]]

⥅ related node [[neobook]]

⥅ related node [[neoconservative]]

⥅ related node [[neos]]

⥅ related node [[neovim]]

⥅ related node [[nepomuk]]

⥅ related node [[nerd club]]

⥅ related node [[nerds of the world unite]]

⥅ related node [[ness labs]]

⥅ related node [[nesslabs]]

⥅ related node [[netdata]]

⥅ related node [[netrunnernobody]]

⥅ related node [[netsurf]]

⥅ related node [[nettie lagace]]

⥅ related node [[netwik obsidian]]

⥅ related node [[network science]]

⥅ related node [[network]]

⥅ related node [[neuroyogacara]]

⥅ related node [[neustadt schweiz]]

⥅ related node [[neustart schweiz]]

⥅ related node [[never known]]

⥅ related node [[never wrote]]

⥅ related node [[neverending search]]

⥅ related node [[neverware]]

⥅ related node [[new economic reality]]

⥅ related node [[new games]]

⥅ related node [[new homes for old friends]]

⥅ related node [[new moon yoga]]

⥅ related node [[new music]]

⥅ related node [[newcomblike problems]]

⥅ related node [[newdoc]]

⥅ related node [[newick format]]

⥅ related node [[newick]]

⥅ related node [[newmeme]]

⥅ related node [[news coops]]

⥅ related node [[newsheet]]

⥅ related node [[newslides]]

⥅ related node [[next action]]

⥅ related node [[next23]]

⥅ related node [[nft storage]]

⥅ related node [[nfthh]]

⥅ related node [[nfts]]

⥅ related node [[nginx caching]]

⥅ related node [[nheko]]

⥅ related node [[nick bostrom]]

⥅ related node [[nick cammarata]]

⥅ related node [[nick cave zurich]]

⥅ related node [[nick szabo]]

⥅ related node [[nick vujicic]]

⥅ related node [[nietszche]]

⥅ related node [[nietzsche]]

⥅ related node [[nightly]]

⥅ related node [[nights of cabiria]]

⥅ related node [[nikolai kingsley]]

⥅ related node [[nils frahm]]

⥅ related node [[niplav]]

⥅ related node [[nixsee]]

⥅ related node [[nmcli]]

⥅ related node [[no yoga robots]]

⥅ related node [[nobu hibiki]]

⥅ related node [[noche de los bastones largos]]

⥅ related node [[nocturnal garden]]

⥅ related node [[node club]]

⥅ related node [[node js]]

⥅ related node [[node outlines]]

⥅ related node [[node permutations]]

⥅ related node [[node]]

⥅ related node [[noded]]

⥅ related node [[nodes outlines]]

⥅ related node [[nodes]]

⥅ related node [[noding]]

⥅ related node [[nodos]]

⥅ related node [[noise colors]]

⥅ related node [[nomad]]

⥅ related node [[non profit]]

⥅ related node [[non serviam]]

⥅ related node [[non violence]]

⥅ related node [[non violently]]

⥅ related node [[nonsense]]

⥅ related node [[noocene]]

⥅ related node [[noosphere]]

⥅ related node [[nootropics]]

⥅ related node [[nordbrücke]]

⥅ related node [[normanchella]]

⥅ related node [[nosilverv]]

⥅ related node [[nostromo]]

⥅ related node [[not organized hierarchically]]

⥅ related node [[notation as a tool of thought]]

⥅ related node [[note]]

⥅ related node [[notebooks]]

⥅ related node [[notes on the synthesis of form]]

⥅ related node [[notes]]

⥅ related node [[notifications]]

⥅ related node [[notion]]

⥅ related node [[notsilverv]]

⥅ related node [[notsof]]

⥅ related node [[notverapetrova]]

⥅ related node [[november session]]

⥅ related node [[now]]

⥅ related node [[nownownow]]

⥅ related node [[nox]]

⥅ related node [[noxaxis1]]

⥅ related node [[ntaverna]]

⥅ related node [[nthd3gr33]]

⥅ related node [[nts]]

⥅ related node [[ntv]]

⥅ related node [[nuffsaid]]

⥅ related node [[nugget]]

⥅ related node [[nuggets]]

⥅ related node [[numbers]]

⥅ related node [[numerical discourses of the buddha]]

⥅ related node [[nunca me faltes]]

⥅ related node [[nutshell]]

⥅ related node [[nyc cool kids]]

⥅ related node [[nyiregyhazi]]

⥅ related node [[o oh o oh]]

⥅ related node [[oauth]]

⥅ related node [[obelism]]

⥅ related node [[obelos]]

⥅ related node [[object of design]]

⥅ related node [[oblique strategies]]

⥅ related node [[oblivion]]

⥅ related node [[obreras]]

⥅ related node [[obsidian attachments]]

⥅ related node [[obsidian better tiling]]

⥅ related node [[obsidian block anchors]]

⥅ related node [[obsidian bootstrap]]

⥅ related node [[obsidian embeds]]

⥅ related node [[obsidian git]]

⥅ related node [[obsidian plugin]]

⥅ related node [[obsidian plugins]]

⥅ related node [[obsidian workspaces]]

⥅ related node [[ocalan]]

⥅ related node [[ocarina of time]]

⥅ related node [[ocell]]

⥅ related node [[ocho system]]

⥅ related node [[ocho systems]]

⥅ related node [[octavia butler]]

⥅ related node [[october 2021]]

⥅ related node [[october]]

⥅ related node [[ocälan]]

⥅ related node [[oeis foundation]]

⥅ related node [[oeis]]

⥅ related node [[offering]]

⥅ related node [[offline twitter]]

⥅ related node [[offsets]]

⥅ related node [[ogm]]

⥅ related node [[okupas]]

⥅ related node [[olga babeeva]]

⥅ related node [[oliver sauter]]

⥅ related node [[ollybot]]

⥅ related node [[olofl]]

⥅ related node [[om mani padme hum]]

⥅ related node [[om tare tuttare ture soha]]

⥅ related node [[omar rizwan]]

⥅ related node [[omelas]]

⥅ related node [[omnibus]]

⥅ related node [[omniglot]]

⥅ related node [[on building bridges]]

⥅ related node [[on cringe]]

⥅ related node [[on looking in the past for a better future]]

⥅ related node [[on revolution]]

⥅ related node [[on the establishment of the pure land in the human realm]]

⥅ related node [[on this date]]

⥅ related node [[on tyranny]]

⥅ related node [[on line encyclopedia of integer sequences]]

⥅ related node [[onboarding to the agora]]

⥅ related node [[oncall]]

⥅ related node [[one green one red]]

⥅ related node [[one hour for the revolution]]

⥅ related node [[one hour]]

⥅ related node [[one maitreya]]

⥅ related node [[one path]]

⥅ related node [[one pomodoro]]

⥅ related node [[onenation party]]

⥅ related node [[onkyo volume]]

⥅ related node [[online radio]]

⥅ related node [[online radios]]

⥅ related node [[only flans]]

⥅ related node [[ontologies]]

⥅ related node [[ontology]]

⥅ related node [[open agora questions]]

⥅ related node [[open borders]]

⥅ related node [[open ethics]]

⥅ related node [[open global mind]]

⥅ related node [[open graph protocol]]

⥅ related node [[open graph]]

⥅ related node [[open home]]

⥅ related node [[open infrastructure map]]

⥅ related node [[open letter to avalokiteshvara]]

⥅ related node [[open letter to elon musk]]

⥅ related node [[open letter to foam]]

⥅ related node [[open letter to google]]

⥅ related node [[open letter to hans widmer]]

⥅ related node [[open letter to jigme rinpoche]]

⥅ related node [[open letter to lex fridman]]

⥅ related node [[open letter to lex]]

⥅ related node [[open letter to maitreya]]

⥅ related node [[open letter to milei]]

⥅ related node [[open letter to moloch]]

⥅ related node [[open letter to musk]]

⥅ related node [[open letter to peter singer]]

⥅ related node [[open letter to the agora of flancia]]

⥅ related node [[open letter to the agora]]

⥅ related node [[open letter]]

⥅ related node [[open letters to the agora]]

⥅ related node [[open letters to the readers of the future]]

⥅ related node [[open letters]]

⥅ related node [[open nation]]

⥅ related node [[open protocols]]

⥅ related node [[open repair]]

⥅ related node [[open search]]

⥅ related node [[open source monitoring]]

⥅ related node [[open source]]

⥅ related node [[open street map]]

⥅ related node [[open syllabus]]

⥅ related node [[open letter to sundar]]

⥅ related node [[open]]

⥅ related node [[openai]]

⥅ related node [[openalex]]

⥅ related node [[opening design]]

⥅ related node [[opening the sensory gates]]

⥅ related node [[operation unified assistance]]

⥅ related node [[oprimidos]]

⥅ related node [[opsimath]]

⥅ related node [[opt in]]

⥅ related node [[optin]]

⥅ related node [[opus populi]]

⥅ related node [[opus]]

⥅ related node [[orbit db]]

⥅ related node [[orbitdb]]

⥅ related node [[orejas de terciopelo]]

⥅ related node [[orellano]]

⥅ related node [[org mode markup cheatsheet]]

⥅ related node [[org mode]]

⥅ related node [[org roam]]

⥅ related node [[organic moroccan mint]]

⥅ related node [[organizing circle]]

⥅ related node [[orgparse]]

⥅ related node [[orgpython]]

⥅ related node [[orgzly]]

⥅ related node [[origin story]]

⥅ related node [[orion s arm]]

⥅ related node [[orphan machine]]

⥅ related node [[orthodox jews that wear 80s clothing]]

⥅ related node [[orthogonality hypothesis]]

⥅ related node [[ostranenie]]

⥅ related node [[oteotpl]]

⥅ related node [[other agoras]]

⥅ related node [[ought]]

⥅ related node [[our beautiflu west coast thing]]

⥅ related node [[our flancia]]

⥅ related node [[our mathematical universe]]

⥅ related node [[our memories together online]]

⥅ related node [[our minds]]

⥅ related node [[ourresearch]]

⥅ related node [[out of memory]]

⥅ related node [[outgroup homogeneity effect]]

⥅ related node [[outliner mode]]

⥅ related node [[outside roaring spaceships]]

⥅ related node [[outsider art]]

⥅ related node [[outsider]]

⥅ related node [[ovd info]]

⥅ related node [[overhead]]

⥅ related node [[overlapping markup]]

⥅ related node [[overleaf]]

⥅ related node [[owen]]

⥅ related node [[owned]]

⥅ related node [[ox agora]]

⥅ related node [[ozymandias]]

⥅ related node [[oṃ tāre tu tāre ture soha]]

⥅ related node [[p and h]]

⥅ related node [[p c]]

⥅ related node [[p m ]]

⥅ related node [[p10g]]

⥅ related node [[p5 js]]

⥅ related node [[pablo capanna]]

⥅ related node [[pad]]

⥅ related node [[pads]]

⥅ related node [[pain surprise]]

⥅ related node [[pais]]

⥅ related node [[paladin]]

⥅ related node [[paleoludic]]

⥅ related node [[palimpsest]]

⥅ related node [[pandemic game]]

⥅ related node [[paolo soleri]]

⥅ related node [[paprika]]

⥅ related node [[paradoja de la tolerancia]]

⥅ related node [[paradox of tolerance]]

⥅ related node [[parallel universes]]

⥅ related node [[parasite alchemy]]

⥅ related node [[parathenaea]]

⥅ related node [[parathenaia]]

⥅ related node [[pareto efficiency]]

⥅ related node [[parrhesia]]

⥅ related node [[part of the reason thinking]]

⥅ related node [[part of the reason]]

⥅ related node [[partido interdimensional pirata]]

⥅ related node [[parties]]

⥅ related node [[party]]

⥅ related node [[pasado]]

⥅ related node [[passwords]]

⥅ related node [[past]]

⥅ related node [[pasta frola]]

⥅ related node [[pasted image 20210507225851]]

⥅ related node [[pasted image 20210508021638]]

⥅ related node [[pasted image 20210508021640]]

⥅ related node [[pasted image 20210508021641]]

⥅ related node [[pasted image 20210508114518]]

⥅ related node [[pasted image 20210509113900]]

⥅ related node [[pasted image 20210509113904]]

⥅ related node [[pasted image 20210509183555]]

⥅ related node [[pasted image 20210509183555 png]]

⥅ related node [[pasted image 20210509183857]]

⥅ related node [[pasted image 20210509184843]]

⥅ related node [[pasted image 20210509191633]]

⥅ related node [[pasted image 20210509191940]]

⥅ related node [[pasted image 20210509191948]]

⥅ related node [[pasted image 20210509195859]]

⥅ related node [[pasted image 20210512221849]]

⥅ related node [[pasted image 20210512221900]]

⥅ related node [[pasted image 20210513173507]]

⥅ related node [[pasted image 20210513174950]]

⥅ related node [[pasted image 20210513204029]]

⥅ related node [[pasted image 20210513204503]]

⥅ related node [[pasted image 20210513225146]]

⥅ related node [[pasted image 20210514003545]]

⥅ related node [[pasted image 20210514003600]]

⥅ related node [[pasted image 20210514092030]]

⥅ related node [[pasted image 20210515175119]]

⥅ related node [[pasted image 20210516171838]]

⥅ related node [[pasted image 20210519165045]]

⥅ related node [[pasted image 20210530135545]]

⥅ related node [[pasted image 20210530135718]]

⥅ related node [[pasted image 20210530135755]]

⥅ related node [[pasted image 20210530135825]]

⥅ related node [[pasted image 20210530135906]]

⥅ related node [[pasted image 20210530135937]]

⥅ related node [[pasted image 20210530140048]]

⥅ related node [[pasted image 20210530140116]]

⥅ related node [[pasted image 20210530140203]]

⥅ related node [[pasted image 20210530140223]]

⥅ related node [[pasted image 20210530140255]]

⥅ related node [[pasted image 20210530140312]]

⥅ related node [[pasted image 20210530140330]]

⥅ related node [[pasted image 20210530140421]]

⥅ related node [[pasted image 20210530140543]]

⥅ related node [[pasted image 20210530140623]]

⥅ related node [[pasted image 20210530140657]]

⥅ related node [[pasted image 20210530140711]]

⥅ related node [[pasted image 20210530140748]]

⥅ related node [[pasted image 20210530140849]]

⥅ related node [[pasted image 20210530140955]]

⥅ related node [[pasted image 20210530141056]]

⥅ related node [[pasted image 20210530141124]]

⥅ related node [[pasted image 20210530141159]]

⥅ related node [[pasted image 20210530141245]]

⥅ related node [[pasted image 20210530141302]]

⥅ related node [[pasted image 20210530141330]]

⥅ related node [[pasted image 20210530141404]]

⥅ related node [[pasted image 20210530141427]]

⥅ related node [[pasted image 20210530141507]]

⥅ related node [[pasted image 20210530141542]]

⥅ related node [[pasted image 20210530141611]]

⥅ related node [[pasted image 20210530141716]]

⥅ related node [[pasted image 20210530141809]]

⥅ related node [[pasted image 20210530141831]]

⥅ related node [[pasted image 20210530141857]]

⥅ related node [[pasted image 20210530141942]]

⥅ related node [[pasted image 20210530141956]]

⥅ related node [[pasted image 20210530142018]]

⥅ related node [[pasted image 20210530142110]]

⥅ related node [[pasted image 20210530142206]]

⥅ related node [[pasted image 20210530142319]]

⥅ related node [[pasted image 20210530142330]]

⥅ related node [[pasted image 20210530142425]]

⥅ related node [[pasted image 20210530142541]]

⥅ related node [[pasted image 20210530152313]]

⥅ related node [[pasted image 20210530160133]]

⥅ related node [[pasted image 20210530185513]]

⥅ related node [[pasted image 20210605161611]]

⥅ related node [[pasted image 20210605175117]]

⥅ related node [[pasted image 20210606121049]]

⥅ related node [[pasted image 20210607174918]]

⥅ related node [[pasted image 20210621164333]]

⥅ related node [[pasted image 20210621164806]]

⥅ related node [[pasted image 20210621181235]]

⥅ related node [[pasted image 20210621181350]]

⥅ related node [[pasted image 20210621181428]]

⥅ related node [[pasted image 20210621181527]]

⥅ related node [[pasted image 20210621181612]]

⥅ related node [[pasted image 20210621181810]]

⥅ related node [[pasted image 20210621181916]]

⥅ related node [[pasted image 20210621181952]]

⥅ related node [[pasted image 20210621182053]]

⥅ related node [[pasted image 20210621182232]]

⥅ related node [[pasted image 20210621182336]]

⥅ related node [[pasted image 20210621182425]]

⥅ related node [[pasted image 20210621182802]]

⥅ related node [[pasted image 20210621182826]]

⥅ related node [[pasted image 20210621182856]]

⥅ related node [[pasted image 20210621182907]]

⥅ related node [[pasted image 20210621183257]]

⥅ related node [[pasted image 20210621183359]]

⥅ related node [[pasted image 20210621183412]]

⥅ related node [[pasted image 20210621183652]]

⥅ related node [[pasted image 20210621183702]]

⥅ related node [[pasted image 20210621190657]]

⥅ related node [[pasted image 20210621190740]]

⥅ related node [[pasted image 20210621190857]]

⥅ related node [[pasted image 20210621191148]]

⥅ related node [[pasted image 20210621191248]]

⥅ related node [[pasted image 20210621191347]]

⥅ related node [[pasted image 20210621191452]]

⥅ related node [[pasted image 20210621191635]]

⥅ related node [[pasted image 20210621191655]]

⥅ related node [[pasted image 20210621192106]]

⥅ related node [[pasted image 20210621192126]]

⥅ related node [[pasted image 20210621192227]]

⥅ related node [[pasted image 20210621192359]]

⥅ related node [[pasted image 20210621192811]]

⥅ related node [[pasted image 20210621192913]]

⥅ related node [[pasted image 20210621193629]]

⥅ related node [[pasted image 20210621193910]]

⥅ related node [[pasted image 20210621194038]]

⥅ related node [[pasted image 20210621194137]]

⥅ related node [[pasted image 20210621194249]]

⥅ related node [[pasted image 20210621194301]]

⥅ related node [[pasted image 20210621194430]]

⥅ related node [[pasted image 20210621194707]]

⥅ related node [[pasted image 20210621194757]]

⥅ related node [[pasted image 20210621195544]]

⥅ related node [[pasted image 20210621200846]]

⥅ related node [[pasted image 20210621201134]]

⥅ related node [[pasted image 20210621204540]]

⥅ related node [[pasted image 20210621204550]]

⥅ related node [[pasted image 20210622180552]]

⥅ related node [[pasted image 20210622180605]]

⥅ related node [[pasted image 20210622180659]]

⥅ related node [[pasted image 20210622183029]]

⥅ related node [[pasted image 20210622183043]]

⥅ related node [[pasted image 20210622183156]]

⥅ related node [[pasted image 20210622183300]]

⥅ related node [[pasted image 20210622183328]]

⥅ related node [[pasted image 20210622183447]]

⥅ related node [[pasted image 20210622184938]]

⥅ related node [[pasted image 20210622185107]]

⥅ related node [[pasted image 20210622185313]]

⥅ related node [[pasted image 20210622185624]]

⥅ related node [[pasted image 20210622185629]]

⥅ related node [[pasted image 20210622185702]]

⥅ related node [[pasted image 20210622185739]]

⥅ related node [[pasted image 20210622185938]]

⥅ related node [[pasted image 20210622190022]]

⥅ related node [[pasted image 20210622190059]]

⥅ related node [[pasted image 20210622190553]]

⥅ related node [[pasted image 20210622190651]]

⥅ related node [[pasted image 20210622191857]]

⥅ related node [[pasted image 20210623181911]]

⥅ related node [[pasted image 20210623182151]]

⥅ related node [[pasted image 20210623182254]]

⥅ related node [[pasted image 20210623182349]]

⥅ related node [[pasted image 20210623183510]]

⥅ related node [[pasted image 20210623184044]]

⥅ related node [[pasted image 20210623184058]]

⥅ related node [[pasted image 20210623184257]]

⥅ related node [[pasted image 20210623184338]]

⥅ related node [[pasted image 20210623184405]]

⥅ related node [[pasted image 20210623184830]]

⥅ related node [[pasted image 20210623185019]]

⥅ related node [[pasted image 20210623185202]]

⥅ related node [[pasted image 20210623192007]]

⥅ related node [[pasted image 20210623192112]]

⥅ related node [[pasted image 20210623192309]]

⥅ related node [[pasted image 20210624180959]]

⥅ related node [[pasted image 20210624181009]]

⥅ related node [[pasted image 20210624181210]]

⥅ related node [[pasted image 20210624181355]]

⥅ related node [[pasted image 20210624181627]]

⥅ related node [[pasted image 20210624181841]]

⥅ related node [[pasted image 20210624182124]]

⥅ related node [[pasted image 20210624182655]]

⥅ related node [[pasted image 20210624183529]]

⥅ related node [[pasted image 20210624183806]]

⥅ related node [[pasted image 20210624185531]]

⥅ related node [[pasted image 20210625144520]]

⥅ related node [[pasted image 20210625180758]]

⥅ related node [[pasted image 20210625181108]]

⥅ related node [[pasted image 20210625181225]]

⥅ related node [[pasted image 20210625181445]]

⥅ related node [[pasted image 20210625181529]]

⥅ related node [[pasted image 20210625181947]]

⥅ related node [[pasted image 20210625182216]]

⥅ related node [[pasted image 20210625182412]]

⥅ related node [[pasted image 20210625182730]]

⥅ related node [[pasted image 20210625183016]]

⥅ related node [[pasted image 20210625183735]]

⥅ related node [[pasted image 20210625190720]]

⥅ related node [[pasted image 20210625190825]]

⥅ related node [[pasted image 20210625191200]]

⥅ related node [[pasted image 20210703185115]]

⥅ related node [[pasted image 20210703185116]]

⥅ related node [[pasted image 20210703185118 1]]

⥅ related node [[pasted image 20210703185118]]

⥅ related node [[pasted image 20210703185119]]

⥅ related node [[pasted image 20210703185422]]

⥅ related node [[pasted image 20210714003755]]

⥅ related node [[pasted image 20210717153526]]

⥅ related node [[pasted image 20210717153545]]

⥅ related node [[pasted image 20210717153556]]

⥅ related node [[pasted image 20210717210424]]

⥅ related node [[pasted image 20210718144905]]

⥅ related node [[pasted image 20210718150713]]

⥅ related node [[pasted image 20210718150742]]

⥅ related node [[pasted image 20210718150828]]

⥅ related node [[pasted image 20210718151545]]

⥅ related node [[pasted image 20210718155034]]

⥅ related node [[pasted image 20210718155038]]

⥅ related node [[pasted image 20210718162616]]

⥅ related node [[pasted image 20210718162620]]

⥅ related node [[pasted image 20210718225748]]

⥅ related node [[pasted image 20210718231941]]

⥅ related node [[pasted image 20210718234132]]

⥅ related node [[pasted image 20210718234343]]

⥅ related node [[pasted image 20210719000516]]

⥅ related node [[pasted image 20210719000525]]

⥅ related node [[pasted image 20210719001721]]

⥅ related node [[pasted image 20210719003436]]

⥅ related node [[pasted image 20210719003446]]

⥅ related node [[pasted image 20210719003520]]

⥅ related node [[pasted image 20210719005502]]

⥅ related node [[pasted image 20210719010243]]

⥅ related node [[pasted image 20210719010634]]

⥅ related node [[pasted image 20210723191851]]

⥅ related node [[pasted image 20210723192041]]

⥅ related node [[pasted image 20210723192119]]

⥅ related node [[pasted image 20210723192758]]

⥅ related node [[pasted image 20210725172843]]

⥅ related node [[pasted image 20210725180901]]

⥅ related node [[pasted image 20210725190339]]

⥅ related node [[pasted image 20210725191249]]

⥅ related node [[pasted image 20210725191304]]

⥅ related node [[pasted image 20210725191910]]

⥅ related node [[pasted image 20210725192533]]

⥅ related node [[pasted image 20210725193042]]

⥅ related node [[pasted image 20210725193123]]

⥅ related node [[pasted image 20210725193413]]

⥅ related node [[pasted image 20210728222617]]

⥅ related node [[pasted image 20210728222623]]

⥅ related node [[paterson]]

⥅ related node [[path]]

⥅ related node [[pattern chosen]]

⥅ related node [[pattern language]]

⥅ related node [[pattern languages of programs]]

⥅ related node [[pattern theory]]

⥅ related node [[pattern]]

⥅ related node [[patterning glossary]]

⥅ related node [[patterning reading group]]

⥅ related node [[patterning]]

⥅ related node [[patterns everywhere]]

⥅ related node [[patterns of commoning]]

⥅ related node [[patterns]]

⥅ related node [[paul bricman]]

⥅ related node [[paul frazee]]

⥅ related node [[paula trama]]

⥅ related node [[paulbucks]]

⥅ related node [[paulus akademie]]

⥅ related node [[pav bhaji]]

⥅ related node [[pay forward]]

⥅ related node [[pay it forward]]

⥅ related node [[paying it forward]]

⥅ related node [[payoff]]

⥅ related node [[pañcasikha]]

⥅ related node [[pbs space time]]

⥅ related node [[pdb post morte]]

⥅ related node [[pdb postmortem]]

⥅ related node [[peace piece]]

⥅ related node [[peaceful]]

⥅ related node [[peak honesty capitalism]]

⥅ related node [[pearson correlation coefficient]]

⥅ related node [[pebble beach]]

⥅ related node [[pee zombie]]

⥅ related node [[peers]]

⥅ related node [[pelican]]

⥅ related node [[pen coded]]

⥅ related node [[pentadactyl]]

⥅ related node [[people]]

⥅ related node [[pep8]]

⥅ related node [[per aspera ad astra]]

⥅ related node [[perhaps naive]]

⥅ related node [[perhaps]]

⥅ related node [[perkeep]]

⥅ related node [[permaculture]]

⥅ related node [[permanent]]

⥅ related node [[pernambuco e seu conjunto]]

⥅ related node [[pernambuco]]

⥅ related node [[pers![[pasted imag![[pasted image 20210703185116 png]]

⥅ related node [[pers![[pasted image 20210703185115 png]]

⥅ related node [[persistent non symbolic experiences]]

⥅ related node [[person from porlock]]

⥅ related node [[person]]

⥅ related node [[personal dynamic media]]

⥅ related node [[personal knowledge graph]]

⥅ related node [[personal knowledge graphs]]

⥅ related node [[personal knowledge management is bullshit]]

⥅ related node [[personal knowledge management]]

⥅ related node [[personal knowledge managment]]

⥅ related node [[personality]]

⥅ related node [[pesho ivanov]]

⥅ related node [[pesho]]

⥅ related node [[pesos]]

⥅ related node [[pestalozzi]]

⥅ related node [[peter greenaway]]

⥅ related node [[peter hagen]]

⥅ related node [[peter kaminski]]

⥅ related node [[peter limberg]]

⥅ related node [[peter singer]]

⥅ related node [[peter thiel]]

⥅ related node [[peter]]

⥅ related node [[peternlimberg]]

⥅ related node [[peternlindberg]]

⥅ related node [[peterson žižek debate]]

⥅ related node [[petrichor]]

⥅ related node [[petter johansson]]

⥅ related node [[petter]]

⥅ related node [[pfeilstorch]]

⥅ related node [[pfrazee]]

⥅ related node [[phalanstery]]

⥅ related node [[phanpy]]

⥅ related node [[phenomenology of reading and writing]]

⥅ related node [[phiinstalllosophy]]

⥅ related node [[phil jones]]

⥅ related node [[phil]]

⥅ related node [[philanthropy]]

⥅ related node [[philip k dick]]

⥅ related node [[philosopher life]]

⥅ related node [[philosophers]]

⥅ related node [[philosophy on alerting]]

⥅ related node [[phone to note]]

⥅ related node [[photon]]

⥅ related node [[photons]]

⥅ related node [[photopia]]

⥅ related node [[photoprism]]

⥅ related node [[phrack]]

⥅ related node [[piano]]

⥅ related node [[pidgin]]

⥅ related node [[pieces]]

⥅ related node [[piero della francesca]]

⥅ related node [[pierre joseph proudhon]]

⥅ related node [[piglia]]

⥅ related node [[pikaso]]

⥅ related node [[pin13 net]]

⥅ related node [[pinafore shortcuts]]

⥅ related node [[pinhole]]

⥅ related node [[pinned]]

⥅ related node [[pinstallhiinstalllosophy]]

⥅ related node [[pinstallhiinstalllosophypinstallhiinstalllosophy]]

⥅ related node [[pip]]

⥅ related node [[pipboy 3000]]

⥅ related node [[pipe alias]]

⥅ related node [[pipe alias|pipe aliases]]

⥅ related node [[pipewire]]

⥅ related node [[pixelfed]]

⥅ related node [[pkd]]

⥅ related node [[pkg book]]

⥅ related node [[pkm book]]

⥅ related node [[pkm tools]]

⥅ related node [[pkm]]

⥅ related node [[pkmchat]]

⥅ related node [[place subreddit]]

⥅ related node [[place]]

⥅ related node [[places for the soul]]

⥅ related node [[places]]

⥅ related node [[plan 9]]

⥅ related node [[plan b]]

⥅ related node [[planet hof]]

⥅ related node [[planet hopf]]

⥅ related node [[planned action]]

⥅ related node [[planned actions]]

⥅ related node [[plantasia]]

⥅ related node [[plantey]]

⥅ related node [[plato]]

⥅ related node [[platonic ideal]]

⥅ related node [[platonic intent]]

⥅ related node [[platos dialogues]]

⥅ related node [[play bach]]

⥅ related node [[please contain yourself]]

⥅ related node [[please don t use discord for foss projects]]

⥅ related node [[please dont use discord for foss projects]]

⥅ related node [[please]]

⥅ related node [[pleco]]

⥅ related node [[pleroma]]

⥅ related node [[plesmasquerade]]

⥅ related node [[plitnyakovo]]

⥅ related node [[plugs]]

⥅ related node [[plum village]]

⥅ related node [[plumber]]

⥅ related node [[plurality]]

⥅ related node [[pobreza]]

⥅ related node [[podagora]]

⥅ related node [[podcast]]

⥅ related node [[podcasts]]

⥅ related node [[poddyssey]]

⥅ related node [[podman unshare]]

⥅ related node [[podman]]

⥅ related node [[poem]]

⥅ related node [[poema de la infancia de alguien]]

⥅ related node [[poems]]

⥅ related node [[poetry pr]]

⥅ related node [[poetry]]

⥅ related node [[poinciana]]

⥅ related node [[pointer]]

⥅ related node [[pokemon mode]]

⥅ related node [[polarization]]

⥅ related node [[polis]]

⥅ related node [[political compass]]

⥅ related node [[polkadot]]

⥅ related node [[poll]]

⥅ related node [[polls]]

⥅ related node [[poly book]]

⥅ related node [[poly]]

⥅ related node [[polycule]]

⥅ related node [[polycultic]]

⥅ related node [[polyfill]]

⥅ related node [[polyform]]

⥅ related node [[polynomial functors]]

⥅ related node [[pom dargent]]

⥅ related node [[pomodoro 0]]

⥅ related node [[pomodoro technique]]

⥅ related node [[pomodoro]]

⥅ related node [[pomodoros for the revolution]]

⥅ related node [[pomodoros]]

⥅ related node [[popperland]]

⥅ related node [[por flancia! qué flancia? tu flancia!]]

⥅ related node [[porch]]

⥅ related node [[porrentruy]]

⥅ related node [[posadism]]

⥅ related node [[posadists]]

⥅ related node [[post racial]]

⥅ related node [[post scarcity]]

⥅ related node [[postmarks]]

⥅ related node [[postponing revolution]]

⥅ related node [[potential]]

⥅ related node [[pottery simulator]]

⥅ related node [[power set]]

⥅ related node [[pr]]

⥅ related node [[prabrothers]]

⥅ related node [[practical guide to the jhanas]]

⥅ related node [[practice]]

⥅ related node [[praise the jewel in the lotus]]

⥅ related node [[prana]]

⥅ related node [[pranayama]]

⥅ related node [[prathyvsh]]

⥅ related node [[pratyush]]

⥅ related node [[praxis]]

⥅ related node [[pre commit]]

⥅ related node [[predictable identities]]

⥅ related node [[prediction framework]]

⥅ related node [[predictionbook]]

⥅ related node [[predictions as a substitute for reviews]]

⥅ related node [[prerationalist]]

⥅ related node [[presentation]]

⥅ related node [[prettier]]

⥅ related node [[prime gaps]]

⥅ related node [[prime]]

⥅ related node [[primes]]

⥅ related node [[primeval forest]]

⥅ related node [[primo levi]]

⥅ related node [[principal agent problem]]

⥅ related node [[principle of charity]]

⥅ related node [[prinssi taivaanlintu]]

⥅ related node [[printer]]

⥅ related node [[priorities]]

⥅ related node [[prioritize]]

⥅ related node [[prisión perpetua]]

⥅ related node [[privado]]

⥅ related node [[private]]

⥅ related node [[test]]

⥅ related node [[prizewinning plus]]

⥅ related node [[prizewinning]]

⥅ related node [[pro socially]]

⥅ related node [[probabilistic p2p content moderation]]

⥅ related node [[problem of universals]]

⥅ related node [[problem solving]]

⥅ related node [[problem]]

⥅ related node [[problems]]

⥅ related node [[proc]]

⥅ related node [[procedure]]

⥅ related node [[procrastination diaries]]

⥅ related node [[procrastination diary]]

⥅ related node [[profession]]

⥅ related node [[profiles]]

⥅ related node [[program]]

⥅ related node [[progressive international]]

⥅ related node [[project cybersin]]

⥅ related node [[project cybersyn]]

⥅ related node [[project euler]]

⥅ related node [[project gemini]]

⥅ related node [[project snapshot]]

⥅ related node [[project underlay]]

⥅ related node [[project]]

⥅ related node [[projection]]

⥅ related node [[proletarian]]

⥅ related node [[proletkult]]

⥅ related node [[prolog]]

⥅ related node [[prometheus]]

⥅ related node [[promiscous]]

⥅ related node [[promnesia agora]]

⥅ related node [[promnesia config]]

⥅ related node [[promnesia example config]]

⥅ related node [[promnesia howto]]

⥅ related node [[promnesia sources]]

⥅ related node [[prompting of creativity]]

⥅ related node [[pronunciatio]]

⥅ related node [[proof game]]

⥅ related node [[proposal]]

⥅ related node [[proposition joe]]

⥅ related node [[proposition]]

⥅ related node [[prosperity license]]

⥅ related node [[prosperity public license]]

⥅ related node [[protean]]

⥅ related node [[protein pudding]]

⥅ related node [[proteíno]]

⥅ related node [[protocol labs]]

⥅ related node [[protocol]]

⥅ related node [[protocolo del ágora]]

⥅ related node [[protocols not platforms]]

⥅ related node [[protopia]]

⥅ related node [[protopian cyberpunk]]

⥅ related node [[protopian thinking]]

⥅ related node [[protopian]]

⥅ related node [[protopians]]

⥅ related node [[protopias]]

⥅ related node [[protopoi org]]

⥅ related node [[protopoi reading club]]

⥅ related node [[protopoi space]]

⥅ related node [[protopoi]]

⥅ related node [[proudhon]]

⥅ related node [[proyecto morcilla]]

⥅ related node [[proyecto nocilla]]

⥅ related node [[prs]]

⥅ related node [[psas]]

⥅ related node [[pseudonym]]

⥅ related node [[pseudonymous]]

⥅ related node [[psionica]]

⥅ related node [[pt]]

⥅ related node [[public ai]]

⥅ related node [[public benefit]]

⥅ related node [[public by default]]

⥅ related node [[public key]]

⥅ related node [[public keys]]

⥅ related node [[public logs]]

⥅ related node [[public utilities]]

⥅ related node [[public utility]]

⥅ related node [[publish agora chapter]]

⥅ related node [[publish agora el]]

⥅ related node [[pubpub]]

⥅ related node [[pula]]

⥅ related node [[pull and push]]

⥅ related node [[pull arbitrary urls]]

⥅ related node [[pull links]]

⥅ related node [[pull prefixes]]

⥅ related node [[pull]]

⥅ related node [[pulled links]]

⥅ related node [[pulled nodes]]

⥅ related node [[pulled]]

⥅ related node [[pulling]]

⥅ related node [[pumpkin soup]]

⥅ related node [[pupilsofroam]]

⥅ related node [[pure land buddhism]]

⥅ related node [[pure land]]

⥅ related node [[push an existing repository to a new remote]]

⥅ related node [[push and pull]]

⥅ related node [[push down automata]]

⥅ related node [[push kindly]]

⥅ related node [[pushing it]]

⥅ related node [[pushing]]

⥅ related node [[puter]]

⥅ related node [[py subnodes]]

⥅ related node [[pyinstrument]]

⥅ related node [[pyramids]]

⥅ related node [[pyro]]

⥅ related node [[python type annotations]]

⥅ related node [[pólis]]

⥅ related node [[qanon]]

⥅ related node [[qntm]]

⥅ related node [[qr code]]

⥅ related node [[qr codes]]

⥅ related node [[qr]]

⥅ related node [[qrencode]]

⥅ related node [[quad9]]

⥅ related node [[qualia computing]]

⥅ related node [[qualia]]

⥅ related node [[quantum computing since democritus]]

⥅ related node [[quantum country]]

⥅ related node [[quantum dice]]

⥅ related node [[quantum mailer]]

⥅ related node [[quantum shotgun]]

⥅ related node [[quasi autonomous emergent property]]

⥅ related node [[querki]]

⥅ related node [[query language]]

⥅ related node [[queue]]

⥅ related node [[quick capture]]

⥅ related node [[quick fix]]

⥅ related node [[quiero ser pirata]]

⥅ related node [[quilapayún]]

⥅ related node [[quinn]]

⥅ related node [[quit]]

⥅ related node [[quote toot]]

⥅ related node [[quote tweet]]

⥅ related node [[quote]]

⥅ related node [[quotebacks]]

⥅ related node [[quotebrowser]]

⥅ related node [[qutebrowser]]

⥅ related node [[qwant]]

⥅ related node [[radical candor]]

⥅ related node [[radicle]]

⥅ related node [[radijo musikii]]

⥅ related node [[radiko musijik]]

⥅ related node [[radio caso]]

⥅ related node [[radiozora]]

⥅ related node [[rael zero]]

⥅ related node [[rafael subirachs]]

⥅ related node [[rafathebuilder]]

⥅ related node [[ragnar]]

⥅ related node [[rain in the city]]

⥅ related node [[rainbow folding]]

⥅ related node [[rainbow williams]]

⥅ related node [[rainer maria rilke]]

⥅ related node [[ralph hodgson]]

⥅ related node [[ramesses ii]]

⥅ related node [[ramon alonso]]

⥅ related node [[ramon llull]]

⥅ related node [[random]]

⥅ related node [[ranking algorithm]]

⥅ related node [[ranking]]

⥅ related node [[rapid sensemaking framework]]

⥅ related node [[rasputitsa]]

⥅ related node [[rational]]

⥅ related node [[rationality]]

⥅ related node [[raymond williams]]

⥅ related node [[rayuela]]

⥅ related node [[rc]]

⥅ related node [[rclone]]

⥅ related node [[rdf 1 1 concepts and abstract syntax]]

⥅ related node [[rdf 1 1 primer]]

⥅ related node [[rdf 1 1 semantics]]

⥅ related node [[rdf 1 1 test cases]]

⥅ related node [[rdf 1 1 xml syntax]]

⥅ related node [[rdf grapher]]

⥅ related node [[rdf schema 1 1]]

⥅ related node [[rdf serialization format]]

⥅ related node [[rdf serialization formats]]

⥅ related node [[rdf]]

⥅ related node [[rdflib]]

⥅ related node [[re decentralizing the web]]

⥅ related node [[re evolution]]

⥅ related node [[reach out]]

⥅ related node [[reactjs]]

⥅ related node [[read if incapacitated]]

⥅ related node [[read]]

⥅ related node [[readers of the future]]

⥅ related node [[reading alexander]]

⥅ related node [[reading club]]

⥅ related node [[reading list]]

⥅ related node [[reading protopoi]]

⥅ related node [[reading vacation june 2020]]

⥅ related node [[real co op stories]]

⥅ related node [[real coop stories]]

⥅ related node [[real ez cheese]]

⥅ related node [[real life]]

⥅ related node [[reality has a surprising amount of detail]]

⥅ related node [[reasonable movement]]

⥅ related node [[receive]]

⥅ related node [[recharging alkalines]]

⥅ related node [[recipe gate]]

⥅ related node [[recipe]]

⥅ related node [[recipes]]

⥅ related node [[recursive media]]

⥅ related node [[recursive]]

⥅ related node [[recursivity]]

⥅ related node [[red alone]]

⥅ related node [[red house eviction defense]]

⥅ related node [[red oak]]

⥅ related node [[red star]]

⥅ related node [[reddit]]

⥅ related node [[reddy2go]]

⥅ related node [[reed]]

⥅ related node [[reference agora]]

⥅ related node [[reference implementation]]

⥅ related node [[reflect]]

⥅ related node [[reflection]]

⥅ related node [[reflections of knowledge]]

⥅ related node [[refuge]]

⥅ related node [[refusing to merge unrelated histories]]

⥅ related node [[refute]]

⥅ related node [[regex]]

⥅ related node [[regina ponciano]]

⥅ related node [[registration form]]

⥅ related node [[regular expression]]

⥅ related node [[regulatory capture]]

⥅ related node [[reighleyc]]

⥅ related node [[reimagine the internet]]

⥅ related node [[reinforce]]

⥅ related node [[rel me]]

⥅ related node [[relax instance registration]]

⥅ related node [[release process]]

⥅ related node [[remarkable 2]]

⥅ related node [[remember]]

⥅ related node [[remnote]]

⥅ related node [[remora]]

⥅ related node [[removing google as a spof]]

⥅ related node [[renaissance of the internet]]

⥅ related node [[render py]]

⥅ related node [[renew]]

⥅ related node [[rent free]]

⥅ related node [[repair day]]

⥅ related node [[replenish]]

⥅ related node [[replicated]]

⥅ related node [[repository of patterns]]

⥅ related node [[repository]]

⥅ related node [[republic of letters]]

⥅ related node [[republic]]

⥅ related node [[requirements elicitation]]

⥅ related node [[requisite agility]]

⥅ related node [[reread]]

⥅ related node [[research]]

⥅ related node [[researching social annotation in education]]

⥅ related node [[resolve]]

⥅ related node [[resonance]]

⥅ related node [[resonantpyre]]

⥅ related node [[resonate]]

⥅ related node [[resources to learn to program]]

⥅ related node [[responsibility]]

⥅ related node [[restart pipewire]]

⥅ related node [[restore etherpad revision]]

⥅ related node [[restores]]

⥅ related node [[retro social network]]

⥅ related node [[retroactive public goods funding]]

⥅ related node [[review]]

⥅ related node [[revolt]]

⥅ related node [[revolución argentina de 2023]]

⥅ related node [[revolución correcta]]

⥅ related node [[revolución rusa de 2022]]

⥅ related node [[revolución]]

⥅ related node [[revolution against moloch]]

⥅ related node [[revolution in the 21st century]]

⥅ related node [[revolution in the twenty first century]]

⥅ related node [[revolution]]

⥅ related node [[revolutionary calendar]]

⥅ related node [[revolutions podcast]]

⥅ related node [[revolutions]]

⥅ related node [[rewatch]]

⥅ related node [[rez]]

⥅ related node [[rezmason]]

⥅ related node [[rfc]]

⥅ related node [[rfcs]]

⥅ related node [[rhetoric]]

⥅ related node [[rhizome]]

⥅ related node [[rhizome social]]

⥅ related node [[ribbonfarm]]

⥅ related node [[ricardo piglia]]

⥅ related node [[riccardo ferreti]]

⥅ related node [[riccardo ferretti]]

⥅ related node [[riccardo]]

⥅ related node [[rice cooker]]

⥅ related node [[rich burdon]]

⥅ related node [[richard dawkins]]

⥅ related node [[richard feynman]]

⥅ related node [[richard stallman]]

⥅ related node [[richard wolff]]

⥅ related node [[richdecibels]]

⥅ related node [[right concentration]]

⥅ related node [[right livelihood]]

⥅ related node [[right resolve]]

⥅ related node [[right speech]]

⥅ related node [[right]]

⥅ related node [[rights]]

⥅ related node [[rilke]]

⥅ related node [[risk]]

⥅ related node [[risks]]

⥅ related node [[ritchie]]

⥅ related node [[ritmo de la noche]]

⥅ related node [[ritual]]

⥅ related node [[rival voices]]

⥅ related node [[rna memory]]

⥅ related node [[roam backup]]

⥅ related node [[roam exporter]]

⥅ related node [[roam garden]]

⥅ related node [[roam go links]]

⥅ related node [[roam like]]

⥅ related node [[roam likes]]

⥅ related node [[roam multiplayer]]

⥅ related node [[roam to git]]

⥅ related node [[roam]]

⥅ related node [[roaman agora]]

⥅ related node [[roamanpub]]

⥅ related node [[roamcult]]

⥅ related node [[roamhacker]]

⥅ related node [[rob haisfield]]

⥅ related node [[rob hardy]]

⥅ related node [[rob sanderson]]

⥅ related node [[robbers cave study]]

⥅ related node [[robert anton wilson]]

⥅ related node [[robert axelrod]]

⥅ related node [[robert delaunay]]

⥅ related node [[robert graves]]

⥅ related node [[robert haisfield]]

⥅ related node [[robert kagan]]

⥅ related node [[robert moore]]

⥅ related node [[roberto arlt]]

⥅ related node [[robin hanson]]

⥅ related node [[robofriend as socrates]]

⥅ related node [[robofriend is socrates]]

⥅ related node [[robofriend]]

⥅ related node [[roborock s6]]

⥅ related node [[rode podmic]]

⥅ related node [[rodolfo ocampo]]

⥅ related node [[rodrigo baraglia]]

⥅ related node [[roger eno]]

⥅ related node [[rogue]]

⥅ related node [[roko]]

⥅ related node [[rokos basilisk]]

⥅ related node [[role model]]

⥅ related node [[role models]]

⥅ related node [[romandy]]

⥅ related node [[romanian street musicians]]

⥅ related node [[romantic period poetry]]

⥅ related node [[romina wainberg]]

⥅ related node [[ron gilbert]]

⥅ related node [[roof garden]]

⥅ related node [[root nodes]]

⥅ related node [[root of my garden]]

⥅ related node [[root repository]]

⥅ related node [[rosa sabater]]

⥅ related node [[rosano]]

⥅ related node [[rosario]]

⥅ related node [[rosas y urquiza]]

⥅ related node [[ross perot]]

⥅ related node [[round one]]

⥅ related node [[round two]]

⥅ related node [[round]]

⥅ related node [[rounds]]

⥅ related node [[roxanne gay]]

⥅ related node [[rpg classes]]

⥅ related node [[rpg]]

⥅ related node [[rromea]]

⥅ related node [[rss]]

⥅ related node [[rtc sre playlist]]

⥅ related node [[ruben verborgh]]

⥅ related node [[run run run]]

⥅ related node [[run your own agora]]

⥅ related node [[run]]

⥅ related node [[runko]]

⥅ related node [[rusp]]

⥅ related node [[russel wallace]]

⥅ related node [[russell conjugations]]

⥅ related node [[russian revolution of 2023]]

⥅ related node [[russian revolution]]

⥅ related node [[rust]]

⥅ related node [[rutger bregman]]

⥅ related node [[ruth catlow]]

⥅ related node [[ryan barrett]]

⥅ related node [[ryan faulhaber]]

⥅ related node [[ryan]]

⥅ related node [[ryo fukui]]

⥅ related node [[révolution]]

⥅ related node [[s y]]

⥅ related node [[s s ]]

⥅ related node [[s5bug]]

⥅ related node [[saat phere]]

⥅ related node [[sadalsvvd]]

⥅ related node [[sadhana]]

⥅ related node [[saer tesis]]

⥅ related node [[saer]]

⥅ related node [[saint simon]]

⥅ related node [[saint imier]]

⥅ related node [[sakka]]

⥅ related node [[salons]]

⥅ related node [[salt]]

⥅ related node [[sam harris]]

⥅ related node [[sam whited]]

⥅ related node [[samanta schweblin]]

⥅ related node [[samatha]]

⥅ related node [[same as]]

⥅ related node [[samuel edward konkin iii]]

⥅ related node [[samuel johnson]]

⥅ related node [[samuel klein]]

⥅ related node [[samyutta]]

⥅ related node [[san francisco oracle]]

⥅ related node [[san francisco]]

⥅ related node [[sandra snan]]

⥅ related node [[sandra]]

⥅ related node [[sangha]]

⥅ related node [[santa clarita diet]]

⥅ related node [[santa fe institute]]

⥅ related node [[santa maría]]

⥅ related node [[santicammi]]

⥅ related node [[sapiens]]

⥅ related node [[sapling]]

⥅ related node [[sapper]]

⥅ related node [[sara ishikawa]]

⥅ related node [[sarah friend]]

⥅ related node [[sarah of the past]]

⥅ related node [[sarah schwettmann]]

⥅ related node [[sarahdoingthing]]

⥅ related node [[sariputta]]

⥅ related node [[saturday]]

⥅ related node [[satyagraha revolution]]

⥅ related node [[satyagraha]]

⥅ related node [[saul williams]]

⥅ related node [[sauna thoughts]]

⥅ related node [[save moloch]]

⥅ related node [[saw moloch]]

⥅ related node [[says]]

⥅ related node [[scala]]

⥅ related node [[scaling synthesis]]

⥅ related node [[scatland]]

⥅ related node [[scattered minds]]

⥅ related node [[scc]]

⥅ related node [[schelling and revelation]]

⥅ related node [[schelling point]]

⥅ related node [[schelling points]]

⥅ related node [[schelling pt]]

⥅ related node [[schuldenzucker com]]

⥅ related node [[schuldenzucker]]

⥅ related node [[sci fi]]

⥅ related node [[science fiction]]

⥅ related node [[science]]

⥅ related node [[sciences of the artificial]]

⥅ related node [[scope]]

⥅ related node [[scott aaronson]]

⥅ related node [[scott alexander]]

⥅ related node [[scott]]

⥅ related node [[scottjoe]]

⥅ related node [[scratchpad]]

⥅ related node [[screensharing]]

⥅ related node [[screenshots]]

⥅ related node [[scroll]]

⥅ related node [[scrollback]]

⥅ related node [[sctg]]

⥅ related node [[scumm]]

⥅ related node [[sdxl]]

⥅ related node [[search and annotation are complementary]]

⥅ related node [[search engine]]

⥅ related node [[search engines with own indexes]]

⥅ related node [[searchscene]]

⥅ related node [[searx]]

⥅ related node [[seballot]]

⥅ related node [[sebastian gandera]]

⥅ related node [[second brain]]

⥅ related node [[second stoa]]

⥅ related node [[seconds_0]]

⥅ related node [[secretary problem]]

⥅ related node [[secrets]]

⥅ related node [[secular buddhism]]

⥅ related node [[secular buddhist]]

⥅ related node [[secure scuttlebutt]]

⥅ related node [[seeing like a state]]

⥅ related node [[self organizing intelligent matter]]

⥅ related node [[self promotion]]

⥅ related node [[self]]

⥅ related node [[semantic modeling of narrative events]]

⥅ related node [[semantic narratives]]

⥅ related node [[semi public]]

⥅ related node [[sempathy]]

⥅ related node [[sencha zen]]

⥅ related node [[send it to the ceo]]

⥅ related node [[send to kindle]]

⥅ related node [[senegal town]]

⥅ related node [[senior software engineer interview]]

⥅ related node [[sensagora]]

⥅ related node [[sensecraft]]

⥅ related node [[sensedoing]]

⥅ related node [[sensible urls]]

⥅ related node [[sentry]]

⥅ related node [[separation]]

⥅ related node [[seph]]

⥅ related node [[sequence]]

⥅ related node [[sequences]]

⥅ related node [[sequential wiki]]

⥅ related node [[series]]

⥅ related node [[servers]]

⥅ related node [[set]]

⥅ related node [[settings conflicted 1723774236035]]

⥅ related node [[settings]]

⥅ related node [[seven bridges of königsberg]]

⥅ related node [[seven maitreyas]]

⥅ related node [[seven of nine]]

⥅ related node [[seven sketches in compositionality]]

⥅ related node [[severance]]

⥅ related node [[sevilla 2025]]

⥅ related node [[sex tips for geeks]]

⥅ related node [[sgmk]]

⥅ related node [[sgtm]]

⥅ related node [[shakyamuni]]

⥅ related node [[shamanic agora]]

⥅ related node [[shamanic coders guild]]

⥅ related node [[shamanpunk]]

⥅ related node [[shambala]]

⥅ related node [[shambhala buddhism]]

⥅ related node [[shambhala]]

⥅ related node [[shambhala the sacred path of the warrior]]

⥅ related node [[shantideva]]

⥅ related node [[shape of my heart]]

⥅ related node [[share freely]]

⥅ related node [[shareable things]]

⥅ related node [[shared notes across six tools]]

⥅ related node [[sharing economy]]

⥅ related node [[sharpie]]

⥅ related node [[sharpies]]

⥅ related node [[shawn kanungo]]

⥅ related node [[shawn murphy]]

⥅ related node [[shelling]]

⥅ related node [[shi ne]]

⥅ related node [[shift]]

⥅ related node [[shinzen young]]

⥅ related node [[ship]]

⥅ related node [[shirtless guy]]

⥅ related node [[short story]]

⥅ related node [[shortbread recipe]]

⥅ related node [[shortlist]]

⥅ related node [[shu omi]]

⥅ related node [[siafu]]

⥅ related node [[sicm]]

⥅ related node [[siddharta gautama]]

⥅ related node [[side projects]]

⥅ related node [[sidebery]]

⥅ related node [[sidequest]]

⥅ related node [[siedlung halen]]

⥅ related node [[siepomaga]]

⥅ related node [[siggibecker]]

⥅ related node [[sign in]]

⥅ related node [[sign up]]

⥅ related node [[signal]]

⥅ related node [[signup]]

⥅ related node [[signups]]

⥅ related node [[sila]]

⥅ related node [[silence is a commons]]

⥅ related node [[silicon jungle]]

⥅ related node [[silke helfrich]]

⥅ related node [[silly]]

⥅ related node [[silver ladders]]

⥅ related node [[silverbullet bug]]

⥅ related node [[silverbullet multi tenancy]]

⥅ related node [[silverbullet]]

⥅ related node [[simcity 2000]]

⥅ related node [[simon willison]]

⥅ related node [[simple]]

⥅ related node [[simpotus]]

⥅ related node [[simulate me]]

⥅ related node [[simulated annealing]]

⥅ related node [[simulation contract]]

⥅ related node [[singular plural]]

⥅ related node [[singularity church of the machine god]]

⥅ related node [[singularity church]]

⥅ related node [[singularity]]

⥅ related node [[sinhalese]]

⥅ related node [[siphon]]

⥅ related node [[siphons]]

⥅ related node [[sistema b]]

⥅ related node [[sister sites]]

⥅ related node [[sisters with transistors]]

⥅ related node [[site reliability engineer]]

⥅ related node [[site reliability engineering]]

⥅ related node [[siw]]

⥅ related node [[six degrees]]

⥅ related node [[six easy pieces]]

⥅ related node [[sj]]

⥅ related node [[sje]]

⥅ related node [[sketch engine]]

⥅ related node [[skreutzer]]

⥅ related node [[skribbld]]

⥅ related node [[slaps]]

⥅ related node [[slate star codex]]

⥅ related node [[slavoj zizek]]

⥅ related node [[slavoj žižek]]

⥅ related node [[slay moloch]]

⥅ related node [[slay]]

⥅ related node [[slaying moloch]]

⥅ related node [[sleeper trains]]

⥅ related node [[sleeping beauty problem]]

⥅ related node [[slo]]

⥅ related node [[slopi]]

⥅ related node [[slow focus]]

⥅ related node [[slugify]]

⥅ related node [[small axe]]

⥅ related node [[smallcircles]]

⥅ related node [[smart agora]]

⥅ related node [[smarter than me]]

⥅ related node [[snapshot]]

⥅ related node [[snapshots]]

⥅ related node [[snarayan]]

⥅ related node [[snorri sturluson]]

⥅ related node [[snufkin]]

⥅ related node [[so you want to learn physics]]

⥅ related node [[so you want to talk about race]]

⥅ related node [[sobre el sentido poético de la vida]]

⥅ related node [[social algorithm]]

⥅ related node [[social coding foundations]]

⥅ related node [[social coop admin]]

⥅ related node [[social coop announcements]]

⥅ related node [[social coop bridge]]

⥅ related node [[social coop community wg]]

⥅ related node [[social coop hosting]]

⥅ related node [[social coop issues]]

⥅ related node [[social coop matrix bridge]]

⥅ related node [[social coop matrix]]

⥅ related node [[social coop second instance]]

⥅ related node [[social coop servers]]

⥅ related node [[social coop tech chat]]

⥅ related node [[social coop tech group minutes]]

⥅ related node [[social coop tech group]]

⥅ related node [[social coop tech]]

⥅ related node [[social coop terms]]

⥅ related node [[social coop wiki]]

⥅ related node [[social democratic party of switzerland]]

⥅ related node [[social distributed knowledge graph]]

⥅ related node [[social feeds]]

⥅ related node [[social knowledge graph]]

⥅ related node [[social knowledge graphs discussion]]

⥅ related node [[social knowledge graphs]]

⥅ related node [[social learning across content]]

⥅ related node [[social media for anarchists]]

⥅ related node [[social network]]

⥅ related node [[social roots]]

⥅ related node [[social web protocols]]

⥅ related node [[social]]

⥅ related node [[socialist]]

⥅ related node [[society of mind]]

⥅ related node [[socrates figures]]

⥅ related node [[socrates]]

⥅ related node [[sodaaddict105]]

⥅ related node [[soft focus]]

⥅ related node [[solarpunk]]

⥅ related node [[solid]]

⥅ related node [[solidarity]]

⥅ related node [[solidary]]

⥅ related node [[solipsist]]

⥅ related node [[solokeys]]

⥅ related node [[solomon naim]]

⥅ related node [[solutions]]

⥅ related node [[solve poverty]]

⥅ related node [[soma fm]]

⥅ related node [[soma]]

⥅ related node [[some days i feel like slaying moloch]]

⥅ related node [[some possible paths to flancia]]

⥅ related node [[some things must be believed in order to be seen]]

⥅ related node [[sometimes i feel as if i am struck by lightning]]

⥅ related node [[sonate]]

⥅ related node [[sophia xu]]

⥅ related node [[sota]]

⥅ related node [[soulseek]]

⥅ related node [[sounds of the dawn]]

⥅ related node [[sources of truth]]

⥅ related node [[sources yaml]]

⥅ related node [[sources]]

⥅ related node [[sowing the seeds of love]]

⥅ related node [[soy cuba]]

⥅ related node [[sp schweiz]]

⥅ related node [[sp]]

⥅ related node [[space flower]]

⥅ related node [[space]]

⥅ related node [[spacehey]]

⥅ related node [[spaces to tabs conversion]]

⥅ related node [[spaces]]

⥅ related node [[spain]]

⥅ related node [[spam trap fix]]

⥅ related node [[spanish passport]]

⥅ related node [[sparql]]

⥅ related node [[specific public intention]]

⥅ related node [[speculative annotation]]

⥅ related node [[speech and language processing]]

⥅ related node [[spiderfoods]]

⥅ related node [[spiel]]

⥅ related node [[spin dictators]]

⥅ related node [[spirit cloth]]

⥅ related node [[split domain deployment]]

⥅ related node [[spoon theory]]

⥅ related node [[spotify]]

⥅ related node [[spotting emotions]]

⥅ related node [[spoudaiogeloion]]

⥅ related node [[spritzle]]

⥅ related node [[sqlite code of ethics]]

⥅ related node [[sqlite]]

⥅ related node [[sre]]

⥅ related node [[sri lanka]]

⥅ related node [[srs]]

⥅ related node [[ssh keys]]

⥅ related node [[st benedict rule for monasteries]]

⥅ related node [[st benedict s rule for monasteries]]

⥅ related node [[st imier]]

⥅ related node [[st]]

⥅ related node [[stable diffusion xl]]

⥅ related node [[stack exchange]]

⥅ related node [[stack overflow]]

⥅ related node [[stack]]

⥅ related node [[stand on zanzibar]]

⥅ related node [[standardgalatic]]

⥅ related node [[standards positions]]

⥅ related node [[standoff properties]]

⥅ related node [[stanislaw lem]]

⥅ related node [[stapelberg]]

⥅ related node [[starbyte]]

⥅ related node [[start writing]]

⥅ related node [[starting writing]]

⥅ related node [[startupy]]

⥅ related node [[state of higher order]]

⥅ related node [[statement of intent]]

⥅ related node [[static site generator]]

⥅ related node [[steffen schuldenzucker]]

⥅ related node [[stephane pigeon]]

⥅ related node [[stephanie]]

⥅ related node [[stephen batchelor]]

⥅ related node [[stephen crane]]

⥅ related node [[stephen downes]]

⥅ related node [[stephen wolfram]]

⥅ related node [[steve blank]]

⥅ related node [[steve hauschildt]]

⥅ related node [[steve mcqueen]]

⥅ related node [[steve roach]]

⥅ related node [[steve wozniak]]

⥅ related node [[stevefloyds]]

⥅ related node [[steven fan]]

⥅ related node [[steven levy]]

⥅ related node [[steward]]

⥅ related node [[stewards]]

⥅ related node [[sting]]

⥅ related node [[stoa nodes]]

⥅ related node [[stoa of attalos]]

⥅ related node [[stoa poikile]]

⥅ related node [[stoa subnodes]]

⥅ related node [[stoa sync]]

⥅ related node [[stoas]]

⥅ related node [[stone soup]]

⥅ related node [[stoner]]

⥅ related node [[stories]]

⥅ related node [[storm]]

⥅ related node [[stpa handbook]]

⥅ related node [[stpa workshop]]

⥅ related node [[stpa]]

⥅ related node [[straight as an arrow]]

⥅ related node [[straumli ai]]

⥅ related node [[straw]]

⥅ related node [[stream audio over the network]]

⥅ related node [[stream]]

⥅ related node [[strength in diversity]]

⥅ related node [[strength]]

⥅ related node [[struck by lightning]]

⥅ related node [[structure and interpretation of classical mechanics]]

⥅ related node [[structure and interpretation of computer programs]]

⥅ related node [[structured conversational communication]]

⥅ related node [[subconscious]]

⥅ related node [[subjective censorship]]

⥅ related node [[subnode]]

⥅ related node [[subnodes]]

⥅ related node [[subtext]]

⥅ related node [[subtitles]]

⥅ related node [[sucederá]]

⥅ related node [[suffering]]

⥅ related node [[sull]]

⥅ related node [[summer night]]

⥅ related node [[summer 2021]]

⥅ related node [[summertime]]

⥅ related node [[sun salutations]]

⥅ related node [[sundar pichai]]

⥅ related node [[sunday]]

⥅ related node [[sundays for hacking]]

⥅ related node [[super adventure island]]

⥅ related node [[superstructure]]

⥅ related node [[supported formats]]

⥅ related node [[surely you re joking]]

⥅ related node [[surplus value]]

⥅ related node [[survey of annotation efforts]]

⥅ related node [[susan stebbing]]

⥅ related node [[susannah]]

⥅ related node [[sutty]]

⥅ related node [[suzuki]]

⥅ related node [[svaha]]

⥅ related node [[svelte]]

⥅ related node [[sway]]

⥅ related node [[swiss wiring code]]

⥅ related node [[switch angel]]

⥅ related node [[switzerland]]

⥅ related node [[sylvia townsend]]

⥅ related node [[symbiont]]

⥅ related node [[symbiosis]]

⥅ related node [[symora]]

⥅ related node [[synco]]

⥅ related node [[syntacticsugarglider]]

⥅ related node [[synthesis infrastructures group]]

⥅ related node [[synthesis infrastructures workshop]]

⥅ related node [[synthesis]]

⥅ related node [[syphon]]

⥅ related node [[syphons]]

⥅ related node [[syrian uprising]]

⥅ related node [[system theoretic process analysis]]

⥅ related node [[system]]

⥅ related node [[systemctl]]

⥅ related node [[systemd]]

⥅ related node [[systems]]

⥅ related node [[t s eliot]]

⥅ related node [[t4t radar]]

⥅ related node [[ta eis heauton]]

⥅ related node [[ta heis heauton]]

⥅ related node [[tab discard]]

⥅ related node [[tabfs]]

⥅ related node [[tabs]]

⥅ related node [[tacitronium]]

⥅ related node [[tagline]]

⥅ related node [[taixu]]

⥅ related node [[takahe]]

⥅ related node [[takahē]]

⥅ related node [[take a walk on the wild side]]

⥅ related node [[take it easy]]

⥅ related node [[take refuge]]

⥅ related node [[take your pick]]

⥅ related node [[taken a walk on the wild side]]

⥅ related node [[taleb]]

⥅ related node [[talk by dan dennett]]

⥅ related node [[talon]]

⥅ related node [[tana]]

⥅ related node [[tangjeff0]]

⥅ related node [[tanka]]

⥅ related node [[tanzwerk 101]]

⥅ related node [[tao of programming]]

⥅ related node [[tapir whorf]]

⥅ related node [[tara]]

⥅ related node [[taraburup]]

⥅ related node [[tare tutare ture]]

⥅ related node [[tare tuttare tare tuttare]]

⥅ related node [[tare tuttare]]

⥅ related node [[tasks]]

⥅ related node [[tasshin]]

⥅ related node [[tawakul karman]]

⥅ related node [[taxonomy of ideas]]

⥅ related node [[taxonomy]]

⥅ related node [[tayroga]]

⥅ related node [[tc]]

⥅ related node [[tdrop]]

⥅ related node [[te quiero]]

⥅ related node [[team human]]

⥅ related node [[tech worker]]

⥅ related node [[tech working group]]

⥅ related node [[techne]]

⥅ related node [[technics and time]]

⥅ related node [[techno optimist manifesto]]

⥅ related node [[techno]]

⥅ related node [[technologies of reunion]]

⥅ related node [[technologies]]

⥅ related node [[techpractical]]

⥅ related node [[tectonic shift]]

⥅ related node [[ted nelson]]

⥅ related node [[tei]]

⥅ related node [[telegram]]

⥅ related node [[telekommunism]]

⥅ related node [[telekommunist manifesto]]

⥅ related node [[teleoflexuous]]

⥅ related node [[telepathy]]

⥅ related node [[telling stories]]

⥅ related node [[temporal discounting]]

⥅ related node [[tenderloin]]

⥅ related node [[tenzin gyatso]]

⥅ related node [[teodor heggelund]]

⥅ related node [[teresa]]

⥅ related node [[termdown]]

⥅ related node [[terms]]

⥅ related node [[terrorism is not effective]]

⥅ related node [[terrorismo constructivo]]

⥅ related node [[tesis saer]]

⥅ related node [[test for tld]]

⥅ related node [[test node]]

⥅ related node [[testament]]

⥅ related node [[testamento]]

⥅ related node [[testing 2]]

⥅ related node [[testing meet]]

⥅ related node [[testing node]]

⥅ related node [[testing]]

⥅ related node [[tetraspace grouping]]

⥅ related node [[text2img]]

⥅ related node [[tfm]]

⥅ related node [[tfmpb]]

⥅ related node [[tfp]]

⥅ related node [[tft]]

⥅ related node [[tfti]]

⥅ related node [[thalassemia]]

⥅ related node [[the agora already existed]]

⥅ related node [[the agora as a social knowledge graph]]

⥅ related node [[the agora is a garden of forking paths]]

⥅ related node [[the agora is a liminal entity]]

⥅ related node [[the agora is a markdown convention]]

⥅ related node [[the agora is a markdown extension]]

⥅ related node [[the agora is a markup convention]]

⥅ related node [[the agora is a platform for studying convergence]]

⥅ related node [[the agora is a social knowledge graph]]

⥅ related node [[the agora is a social network built by the people for the people]]

⥅ related node [[the agora is a technology]]

⥅ related node [[the agora is a twitter app]]

⥅ related node [[the agora is an old kind of social network]]

⥅ related node [[the agora or building bridges]]

⥅ related node [[the agora]]

⥅ related node [[the agora a knowledge commons]]

⥅ related node [[the aleph]]

⥅ related node [[the arcades project]]

⥅ related node [[the architecture of computer programming]]

⥅ related node [[the architecture of markets]]

⥅ related node [[the architecture of open source applications]]

⥅ related node [[the art of graceful reloading]]

⥅ related node [[the beginning of infinity]]

⥅ related node [[the bell curve]]

⥅ related node [[the book of patterns]]

⥅ related node [[the carrier bag theory of fiction]]

⥅ related node [[the chemical nature of morphogenesis]]

⥅ related node [[the city in the image of man]]

⥅ related node [[the cloud of unknowing]]

⥅ related node [[the craft of research]]

⥅ related node [[the dancing plague]]

⥅ related node [[the deeper the roots]]

⥅ related node [[the dying earth]]

⥅ related node [[the effective altruism handbook]]

⥅ related node [[the end]]

⥅ related node [[the equitable prose]]

⥅ related node [[the evolution of cooperation]]

⥅ related node [[the expanding circle]]

⥅ related node [[the expanse ui design]]

⥅ related node [[the expanse]]

⥅ related node [[the fable of the dragon tyrant]]

⥅ related node [[the fabric of reality]]

⥅ related node [[the fault of epimetheus]]

⥅ related node [[the federation]]

⥅ related node [[the flower in the lotus]]

⥅ related node [[the friendship realm]]

⥅ related node [[the future is already here it s just not very evenly distributed]]

⥅ related node [[the future is here it s just unevenly distributed]]

⥅ related node [[the future of note taking]]

⥅ related node [[the future of the revolution]]

⥅ related node [[the garden of forking paths]]

⥅ related node [[the gift]]

⥅ related node [[the girl who stole my tamagotchi]]

⥅ related node [[the great reset]]

⥅ related node [[the great tab purge of 2020]]

⥅ related node [[the great transformation]]

⥅ related node [[the hardy tree]]

⥅ related node [[the hum]]

⥅ related node [[the hyperbolic geometry of dmt experiences]]

⥅ related node [[the hyperlink delusion]]

⥅ related node [[the idea of the world]]

⥅ related node [[the innovator s dilemma]]

⥅ related node [[the intelligent social web]]

⥅ related node [[the interlace]]

⥅ related node [[the internet is a series of webs]]

⥅ related node [[the irish washerwoman]]

⥅ related node [[the island]]

⥅ related node [[the kind in yellow]]

⥅ related node [[the king in yellow]]

⥅ related node [[the life you can save]]

⥅ related node [[the little schemer]]

⥅ related node [[the little schemerh]]

⥅ related node [[the machine]]

⥅ related node [[the magic pinch]]

⥅ related node [[the mamas and the papas]]

⥅ related node [[the man in the high castle]]

⥅ related node [[the man who was thursday]]

⥅ related node [[the mind illuminated]]

⥅ related node [[the most important video you ll ever see]]

⥅ related node [[the narrator]]

⥅ related node [[the next ai winter wil lbe due to energy costs]]

⥅ related node [[the next revolution]]

⥅ related node [[the on line encyclopedia of integer sequences]]

⥅ related node [[the one chat]]

⥅ related node [[the one]]

⥅ related node [[the ones who walk away from omelas]]

⥅ related node [[the open boat]]

⥅ related node [[the partially examined life]]

⥅ related node [[the path of love]]

⥅ related node [[the people united will never be defeated]]

⥅ related node [[the pill versus the springhill mine disaster]]

⥅ related node [[the post man]]

⥅ related node [[the postman]]

⥅ related node [[the productivists]]

⥅ related node [[the red wheelbarrow]]

⥅ related node [[the reed wheelbarrow]]

⥅ related node [[the restart project]]

⥅ related node [[the revolution according to chatgpg]]

⥅ related node [[the revolution according to chatgpt]]

⥅ related node [[the revolution in the 21st century]]

⥅ related node [[the revolution will be annotated]]

⥅ related node [[the rise of made in china diplomacy]]

⥅ related node [[the sacred path of the warrior]]

⥅ related node [[the science of enlightenment]]

⥅ related node [[the second coming]]

⥅ related node [[the secret life of veronica]]

⥅ related node [[the secret of monkey island]]

⥅ related node [[the selfish gene]]

⥅ related node [[the set of all possible things]]

⥅ related node [[the shape of my heart]]

⥅ related node [[the sovereign individual]]

⥅ related node [[the story of aaron swartz]]

⥅ related node [[the story of civilization]]

⥅ related node [[the story of the chinese farmer]]

⥅ related node [[the systems view of life]]

⥅ related node [[the things that make me weak and strange get engineered away]]

⥅ related node [[the third revolution]]

⥅ related node [[the time block planner]]

⥅ related node [[the timeless way of building]]

⥅ related node [[the tragedy of the commons]]

⥅ related node [[the trillion dollar equation]]

⥅ related node [[the universal laws of success]]

⥅ related node [[the universe in a single atom]]

⥅ related node [[the virtue of selfishness]]

⥅ related node [[the wire]]

⥅ related node [[the word fuck]]

⥅ related node [[the work of art in the age of mechanical reproduction]]

⥅ related node [[the work of art]]

⥅ related node [[the world at war]]

⥅ related node [[the year of living biblically]]

⥅ related node [[theanine]]

⥅ related node [[thebrain]]

⥅ related node [[theequitableprose]]

⥅ related node [[theory of forms]]

⥅ related node [[theory of value]]

⥅ related node [[theproject is]]

⥅ related node [[therigata]]

⥅ related node [[theruran]]

⥅ related node [[thesephist]]

⥅ related node [[thesis antithesis synthesis]]

⥅ related node [[thesis]]

⥅ related node [[thessaloniki]]

⥅ related node [[thestoa ca]]

⥅ related node [[thewiseturtle]]

⥅ related node [[thiftbooks]]

⥅ related node [[thing that is]]

⥅ related node [[thing]]

⥅ related node [[things that are a cheap regex away]]

⥅ related node [[things to do after agora chapter]]

⥅ related node [[things]]

⥅ related node [[think about]]

⥅ related node [[thinking in systems]]

⥅ related node [[thinking tools map project]]

⥅ related node [[thinking tools map]]

⥅ related node [[thinking]]

⥅ related node [[thinkingtools]]

⥅ related node [[third coast percussion]]

⥅ related node [[third stoa]]

⥅ related node [[third]]

⥅ related node [[this agora]]

⥅ related node [[this is how my dad died]]

⥅ related node [[this week]]

⥅ related node [[this weekend]]

⥅ related node [[this x does not exist]]

⥅ related node [[this]]

⥅ related node [[thomae s function]]

⥅ related node [[thomas gray]]

⥅ related node [[thomas lisankie]]

⥅ related node [[thomas more s utopia]]

⥅ related node [[thomas szasz]]

⥅ related node [[thor ciphers]]

⥅ related node [[thor]]

⥅ related node [[those that walk away from omelas]]

⥅ related node [[thought experiment]]

⥅ related node [[thought storms]]

⥅ related node [[thought]]

⥅ related node [[thread helper]]

⥅ related node [[thread mode]]

⥅ related node [[thread viewer]]

⥅ related node [[threadapalooza]]

⥅ related node [[threadhelper]]

⥅ related node [[threadmode]]

⥅ related node [[three gates of speech]]

⥅ related node [[three maitreyas]]

⥅ related node [[three syllables which multiply to eight]]

⥅ related node [[three weeks in sri lanka]]

⥅ related node [[thrive]]

⥅ related node [[thrives]]

⥅ related node [[thriving]]

⥅ related node [[through passages of time]]

⥅ related node [[throw a nine]]

⥅ related node [[throwing dice]]

⥅ related node [[thursday]]

⥅ related node [[tid]]

⥅ related node [[tiddlywiki]]

⥅ related node [[tienson qin]]

⥅ related node [[tier im recht]]

⥅ related node [[tiktok]]

⥅ related node [[tilda]]

⥅ related node [[tillie kottmann]]

⥅ related node [[tim berners lee]]

⥅ related node [[time of writing]]

⥅ related node [[timeline]]

⥅ related node [[timelines]]

⥅ related node [[timetotryagain]]

⥅ related node [[timetotryagain1]]

⥅ related node [[timur ismagilov]]

⥅ related node [[timur]]

⥅ related node [[tindallgrams]]

⥅ related node [[tiny desk]]

⥅ related node [[tit for tat with forgiveness]]

⥅ related node [[tit for tat]]

⥅ related node [[tit for that with forgiveness]]

⥅ related node [[tit for that]]

⥅ related node [[titushora]]

⥅ related node [[tjaulow]]

⥅ related node [[tla]]

⥅ related node [[tmux continuum]]

⥅ related node [[tmux resize]]

⥅ related node [[tmux resurrect]]

⥅ related node [[tmux]]

⥅ related node [[to live and think like pigs]]

⥅ related node [[todas las computadoras que tengo están lentas]]

⥅ related node [[today i failed]]

⥅ related node [[todd carpenter]]

⥅ related node [[todo va mejor con coca cola]]

⥅ related node [[todos]]

⥅ related node [[together to eternity]]

⥅ related node [[together we ll defeat moloch]]

⥅ related node [[together]]

⥅ related node [[tokyo 1960]]

⥅ related node [[tokyo school]]

⥅ related node [[tomorrow s parties]]

⥅ related node [[tomáš]]

⥅ related node [[tool]]

⥅ related node [[toolbar]]

⥅ related node [[tools for conviviality]]

⥅ related node [[tools for thinking]]

⥅ related node [[tools for thought interchange]]

⥅ related node [[tools for thought rocks]]

⥅ related node [[tools for thought]]

⥅ related node [[tools of the agora]]

⥅ related node [[tools]]

⥅ related node [[toot cli]]

⥅ related node [[toot dict]]

⥅ related node [[toots]]

⥅ related node [[tooty]]

⥅ related node [[topic maps]]

⥅ related node [[topic]]

⥅ related node [[topicquests]]

⥅ related node [[topology]]

⥅ related node [[torre eiffel ituizango]]

⥅ related node [[torta base]]

⥅ related node [[tortilla de papas]]

⥅ related node [[total body yoga]]

⥅ related node [[totnes]]

⥅ related node [[tournament]]

⥅ related node [[toward a modern chinese buddhism]]

⥅ related node [[towards a knowledge commons]]

⥅ related node [[towards an agora]]

⥅ related node [[towards flancia]]

⥅ related node [[town hall]]

⥅ related node [[town]]

⥅ related node [[towns]]

⥅ related node [[tpb]]

⥅ related node [[trace programming language]]

⥅ related node [[track]]

⥅ related node [[traditional knowledge]]

⥅ related node [[traficantes de sueños]]

⥅ related node [[trail hub]]

⥅ related node [[trailhub]]

⥅ related node [[trailhub1]]

⥅ related node [[trailmarks]]

⥅ related node [[train back to zürich]]

⥅ related node [[train to lausanne]]

⥅ related node [[transcluded]]

⥅ related node [[transclusion]]

⥅ related node [[transcript]]

⥅ related node [[transition town]]

⥅ related node [[transitive go links]]

⥅ related node [[transmogrify]]

⥅ related node [[trapax]]

⥅ related node [[travel checklist]]

⥅ related node [[treble bass]]

⥅ related node [[tree notation]]

⥅ related node [[tree query]]

⥅ related node [[tree simulator]]

⥅ related node [[tree structure]]

⥅ related node [[tree structured file formats]]

⥅ related node [[tree structures]]

⥅ related node [[tree style tab]]

⥅ related node [[tree style tabs]]

⥅ related node [[treedoc]]

⥅ related node [[trees]]

⥅ related node [[trennungsvereinbarung]]

⥅ related node [[tres consignas]]

⥅ related node [[tres maitreyas]]

⥅ related node [[tres]]

⥅ related node [[tridactyl]]

⥅ related node [[tridactylh]]

⥅ related node [[triooops]]

⥅ related node [[trip to japan]]

⥅ related node [[trip to x]]

⥅ related node [[tripitaka]]

⥅ related node [[tripiṭaka]]

⥅ related node [[trips]]

⥅ related node [[trivially]]

⥅ related node [[trivium]]

⥅ related node [[trotto]]

⥅ related node [[troupe]]

⥅ related node [[troupes]]

⥅ related node [[trubín]]

⥅ related node [[true colors]]

⥅ related node [[true colours]]

⥅ related node [[true names]]

⥅ related node [[trustlamp]]

⥅ related node [[try yoga]]

⥅ related node [[trying to disable slugs]]

⥅ related node [[trypophilism]]

⥅ related node [[tschenresi sadhana]]

⥅ related node [[tsegue maryam guebrou]]

⥅ related node [[tsundoku]]

⥅ related node [[ttl]]

⥅ related node [[ttm]]

⥅ related node [[ttwob]]

⥅ related node [[tuberculosis]]

⥅ related node [[tubular bells]]

⥅ related node [[tuesday]]

⥅ related node [[tulir]]

⥅ related node [[tulse luper]]

⥅ related node [[tumper]]

⥅ related node [[turing]]

⥅ related node [[turlingb]]

⥅ related node [[turner]]

⥅ related node [[turtle]]

⥅ related node [[tv series]]

⥅ related node [[tweet]]

⥅ related node [[tweets]]

⥅ related node [[twg bugs]]

⥅ related node [[twg]]

⥅ related node [[twice the first time]]

⥅ related node [[twilio]]

⥅ related node [[twin primes]]

⥅ related node [[twisty little passages]]

⥅ related node [[twitter 429s]]

⥅ related node [[twitter agora bot]]

⥅ related node [[twitter agora integration]]

⥅ related node [[twitter analytics]]

⥅ related node [[twitter api]]

⥅ related node [[twitter bridge]]

⥅ related node [[twitter could be an agora]]

⥅ related node [[twitter d d roles]]

⥅ related node [[twitter dall e]]

⥅ related node [[twitter developer agreement]]

⥅ related node [[twitter embeds without tracking]]

⥅ related node [[twitter embeds]]

⥅ related node [[twitter feature requests]]

⥅ related node [[twitter go links]]

⥅ related node [[twitter limits]]

⥅ related node [[twitter outage]]

⥅ related node [[twitter poll]]

⥅ related node [[twitter report]]

⥅ related node [[twitter to roam]]

⥅ related node [[twitter todo]]

⥅ related node [[twitter zhuangzi]]

⥅ related node [[two maitreyas]]

⥅ related node [[two straight arrows]]

⥅ related node [[ty]]

⥅ related node [[tyler alterman]]

⥅ related node [[tyleralterman]]

⥅ related node [[tymothy snyder]]

⥅ related node [[type something nice]]

⥅ related node [[type0]]

⥅ related node [[typescript]]

⥅ related node [[typing cat]]

⥅ related node [[tío]]

⥅ related node [[törbel]]

⥅ related node [[ubi zurich]]

⥅ related node [[ubi]]

⥅ related node [[ubiquituous]]

⥅ related node [[ucan]]

⥅ related node [[uchronia]]

⥅ related node [[udit vira]]

⥅ related node [[udit]]

⥅ related node [[ui]]

⥅ related node [[ultra fractal]]

⥅ related node [[umarell]]

⥅ related node [[umwerfend]]

⥅ related node [[un goals for sustainable development]]

⥅ related node [[un goals]]

⥅ related node [[un maitreya]]

⥅ related node [[un mundo común]]

⥅ related node [[un objectives]]

⥅ related node [[un]]

⥅ related node [[una hora para la revolución]]

⥅ related node [[unasanu]]

⥅ related node [[unbundling tools for thought]]

⥅ related node [[underground press syndicate]]

⥅ related node [[underlay project]]

⥅ related node [[understanding knowledge as a commons]]

⥅ related node [[understory]]

⥅ related node [[unexpected taxes]]

⥅ related node [[unfair privilege]]

⥅ related node [[unfinished]]

⥅ related node [[unfollow]]

⥅ related node [[unicef]]

⥅ related node [[unicode arrows]]

⥅ related node [[unicode search]]

⥅ related node [[unicode slugify]]

⥅ related node [[unicode]]

⥅ related node [[unified inbox startup]]

⥅ related node [[unigraph]]

⥅ related node [[united federation of discourse graphs]]

⥅ related node [[units of collaboration]]

⥅ related node [[universal basic income]]

⥅ related node [[universal gate chapter]]

⥅ related node [[universal paperclips]]

⥅ related node [[universe]]

⥅ related node [[unix philosophy]]

⥅ related node [[unix]]

⥅ related node [[unknownquant]]

⥅ related node [[unlicense]]

⥅ related node [[unlikely]]

⥅ related node [[unnamed culture project]]

⥅ related node [[unqualified reservations]]

⥅ related node [[unread]]

⥅ related node [[unskillful]]

⥅ related node [[unsloth]]

⥅ related node [[untitled 1]]

⥅ related node [[untitled 2]]

⥅ related node [[untitled 3]]

⥅ related node [[untitled 4]]

⥅ related node [[untitled 5]]

⥅ related node [[untitled 6]]

⥅ related node [[untitled goose game]]

⥅ related node [[unwalled garden]]

⥅ related node [[upgrade capitalism]]

⥅ related node [[uplifting]]

⥅ related node [[urban]]

⥅ related node [[urbit]]

⥅ related node [[url feeds]]

⥅ related node [[urshanabi]]

⥅ related node [[ursula k le guin]]

⥅ related node [[ursulet]]

⥅ related node [[ursulogalvan]]

⥅ related node [[us trip 2022]]

⥅ related node [[us trip 2023]]

⥅ related node [[us]]

⥅ related node [[usability]]

⥅ related node [[usb midi]]

⥅ related node [[useful definitions]]

⥅ related node [[useful]]

⥅ related node [[user links]]

⥅ related node [[user value]]

⥅ related node [[user]]

⥅ related node [[useradd]]

⥅ related node [[users]]

⥅ related node [[using the agora]]

⥅ related node [[utilitarism]]

⥅ related node [[utopia coffee]]

⥅ related node [[utopia for realists]]

⥅ related node [[utopia]]

⥅ related node [[utopiah]]

⥅ related node [[utopians]]

⥅ related node [[utopoi]]

⥅ related node [[utopía]]

⥅ related node [[uuid]]

⥅ related node [[uv]]

⥅ related node [[uwsgi caching]]

⥅ related node [[uxntal]]

⥅ related node [[v(λ)]]

⥅ related node [[vacation 2020]]

⥅ related node [[vajradhara]]

⥅ related node [[vajrapani]]

⥅ related node [[val flores]]

⥅ related node [[vanguard]]

⥅ related node [[vanna white]]

⥅ related node [[vannevar bush]]

⥅ related node [[vaporwave]]

⥅ related node [[variations]]

⥅ related node [[vathek]]

⥅ related node [[vathy]]

⥅ related node [[vauban]]

⥅ related node [[vault]]

⥅ related node [[vc space]]

⥅ related node [[vc]]

⥅ related node [[vegan backerei]]

⥅ related node [[velintonia]]

⥅ related node [[venceremos a moloch]]

⥅ related node [[vendor lock in]]

⥅ related node [[venv]]

⥅ related node [[vera bug]]

⥅ related node [[vera]]

⥅ related node [[veranda meet]]

⥅ related node [[veranda]]

⥅ related node [[verein welle]]

⥅ related node [[veritasium]]

⥅ related node [[versarial interop]]

⥅ related node [[vessels]]

⥅ related node [[veterinary oerlikon]]

⥅ related node [[veterinary]]

⥅ related node [[vewpoint]]

⥅ related node [[vgel me]]

⥅ related node [[vgn fun]]

⥅ related node [[vibecamp list]]

⥅ related node [[vibecamp]]

⥅ related node [[vibing cat]]

⥅ related node [[vickrey auction]]

⥅ related node [[vicrey auction]]

⥅ related node [[victor hugo]]

⥅ related node [[video wednesdays]]

⥅ related node [[videoeditbot]]

⥅ related node [[vier linden]]

⥅ related node [[views]]

⥅ related node [[vijay shankar v]]

⥅ related node [[village idiot]]

⥅ related node [[ville radieuse]]

⥅ related node [[vimium]]

⥅ related node [[vimrc]]

⥅ related node [[vinay gupta]]

⥅ related node [[vince fakhoury horn]]

⥅ related node [[vinzent]]

⥅ related node [[violence]]

⥅ related node [[violent revolution]]

⥅ related node [[virabhadra]]

⥅ related node [[virabhadrasana]]

⥅ related node [[viral]]

⥅ related node [[virginia astley]]

⥅ related node [[virtual bolo]]

⥅ related node [[virtual veranda]]

⥅ related node [[virtual1nstinct]]

⥅ related node [[virtualbox]]

⥅ related node [[virtualenv]]

⥅ related node [[virtue signaling]]

⥅ related node [[virtue]]

⥅ related node [[visakan]]

⥅ related node [[visakanv]]

⥅ related node [[visible mantra]]

⥅ related node [[visual cortex]]

⥅ related node [[visualizing sep]]

⥅ related node [[vitalik]]

⥅ related node [[vivaldi]]

⥅ related node [[viznut]]

⥅ related node [[vocdoni io]]

⥅ related node [[vocdoni]]

⥅ related node [[voltairine de cleyre]]

⥅ related node [[voltairine de cleyre conflicted 1714833264738]]

⥅ related node [[voltairine de cleyre conflicted 1714835309849]]

⥅ related node [[voltairine de cleyre conflicted 1721431848802]]

⥅ related node [[von neumann]]

⥅ related node [[vos y yo juntos venceremos a moloch]]

⥅ related node [[vote here]]

⥅ related node [[vote to suspend meta]]

⥅ related node [[votes]]

⥅ related node [[voxpub]]

⥅ related node [[voyager]]

⥅ related node [[vrandezo]]

⥅ related node [[vscode extension]]

⥅ related node [[vscode settings sync]]

⥅ related node [[vscode]]

⥅ related node [[vtaiwan]]

⥅ related node [[vundle]]

⥅ related node [[wabi sabi]]

⥅ related node [[wakest]]

⥅ related node [[waking up virtual retreat]]

⥅ related node [[waking up]]

⥅ related node [[walden two]]

⥅ related node [[walk on the wild side]]

⥅ related node [[walk]]

⥅ related node [[walkaway]]

⥅ related node [[walled garden]]

⥅ related node [[walled gardens]]

⥅ related node [[wallstreetbets]]

⥅ related node [[walpola rahula]]

⥅ related node [[walter benjamin]]

⥅ related node [[ward cunningham]]

⥅ related node [[warehouse kawasaki]]

⥅ related node [[warez]]

⥅ related node [[warren mcculloch]]

⥅ related node [[washington]]

⥅ related node [[watch]]

⥅ related node [[watching]]

⥅ related node [[water]]

⥅ related node [[waterfall chart]]

⥅ related node [[waterfall charts]]

⥅ related node [[waters edge]]

⥅ related node [[wayback machine]]

⥅ related node [[waybar]]

⥅ related node [[wayland]]

⥅ related node [[ways to nudge future]]

⥅ related node [[we are the future cunt]]

⥅ related node [[we could be monks in space]]

⥅ related node [[we distribute]]

⥅ related node [[we will be monks in space if we want to]]

⥅ related node [[we will be]]

⥅ related node [[we will defeat moloch]]

⥅ related node [[we will finish what you started]]

⥅ related node [[we will go together into the dark of night]]

⥅ related node [[we ll be monks in space]]

⥅ related node [[we]]

⥅ related node [[weaving a decentralized semantic web of personal knowledge]]

⥅ related node [[web annotations]]

⥅ related node [[web browser]]

⥅ related node [[web browsers]]

⥅ related node [[web dubois]]

⥅ related node [[web ext]]

⥅ related node [[web extension]]

⥅ related node [[web extensions]]

⥅ related node [[web monetization]]

⥅ related node [[web native]]

⥅ related node [[web share]]

⥅ related node [[web0]]

⥅ related node [[webamp]]

⥅ related node [[webaverse]]

⥅ related node [[webcast]]

⥅ related node [[webmentions]]

⥅ related node [[webminar mode]]

⥅ related node [[wedistribute]]

⥅ related node [[wednesday]]

⥅ related node [[wednesdays]]

⥅ related node [[week 12]]

⥅ related node [[week 20]]

⥅ related node [[week]]

⥅ related node [[weekend 11]]

⥅ related node [[weekend 17]]

⥅ related node [[weekend wednesday]]

⥅ related node [[weekend]]

⥅ related node [[weekends]]

⥅ related node [[weekly node club]]

⥅ related node [[weekly plan]]

⥅ related node [[weekly review]]

⥅ related node [[weekly reviews]]

⥅ related node [[weekly]]

⥅ related node [[weeknight]]

⥅ related node [[wefindx]]

⥅ related node [[weierstrass function]]

⥅ related node [[weird one]]

⥅ related node [[welkin core]]

⥅ related node [[welkin]]

⥅ related node [[well intentioned]]

⥅ related node [[wendy doniger]]

⥅ related node [[wendy hanamura]]

⥅ related node [[what about human rights]]

⥅ related node [[what about nazis]]

⥅ related node [[what comes next]]

⥅ related node [[what foreign fighters are seeing in ukraine]]

⥅ related node [[what i do with my time on wednesdays]]

⥅ related node [[what if we became better protopians]]

⥅ related node [[what if we trusted you]]

⥅ related node [[what is a distributed knowledge graph]]

⥅ related node [[what is entropy]]

⥅ related node [[what is flancia like]]

⥅ related node [[what is it like to be a cat]]

⥅ related node [[what shape are you]]

⥅ related node [[what the buddha taught]]

⥅ related node [[what the hell]]

⥅ related node [[what we choose to do with the internet]]

⥅ related node [[whatsapp]]

⥅ related node [[when the agora just works]]

⥅ related node [[where did software go wrong]]

⥅ related node [[where is my light]]

⥅ related node [[where is your light]]

⥅ related node [[where s my light]]

⥅ related node [[which came first]]

⥅ related node [[which other languages should you learn and why]]

⥅ related node [[whipping privilege]]

⥅ related node [[whispered]]

⥅ related node [[white kallax]]

⥅ related node [[white lotus]]

⥅ related node [[white rabbit bakery]]

⥅ related node [[who rules the earth]]

⥅ related node [[whomademecrispy]]

⥅ related node [[why buddhism is true]]

⥅ related node [[why don t we have all]]

⥅ related node [[why don t we have both]]

⥅ related node [[why i am not a buddhist]]

⥅ related node [[why is everyone in such a rush?]]

⥅ related node [[why we can t wait]]

⥅ related node [[why worker cooperatives are a bad strategy]]

⥅ related node [[widevinecdm crashed]]

⥅ related node [[wiki engines]]

⥅ related node [[wiki migration]]

⥅ related node [[wiki modes]]

⥅ related node [[wiki vim]]

⥅ related node [[wikidata integration]]

⥅ related node [[wikidata subsetting]]

⥅ related node [[wikidata]]

⥅ related node [[wikigen]]

⥅ related node [[wikigraph]]

⥅ related node [[wikilink dumping]]

⥅ related node [[wikilink]]

⥅ related node [[wikilinked tools]]

⥅ related node [[wikilinking tools]]

⥅ related node [[wikimedia]]

⥅ related node [[wikinizer]]

⥅ related node [[wikipedia api]]

⥅ related node [[wikipedia lists]]

⥅ related node [[wikis]]

⥅ related node [[wildcard]]

⥅ related node [[will walker]]

⥅ related node [[will]]

⥅ related node [[william carlos williams]]

⥅ related node [[william gibson]]

⥅ related node [[william james]]

⥅ related node [[william macaskill]]

⥅ related node [[wilmer van der gaast]]

⥅ related node [[window manager]]

⥅ related node [[wings of paradise]]

⥅ related node [[wittgenstein plays chess with marcel duchamp]]

⥅ related node [[wittgenstein plays chess]]

⥅ related node [[wittgenstein protocol]]

⥅ related node [[wittgenstein]]

⥅ related node [[wohngenossenschaft]]

⥅ related node [[wohngenossenschaften]]

⥅ related node [[woke]]

⥅ related node [[wolfram physics]]

⥅ related node [[wolfram]]

⥅ related node [[wolftivy]]

⥅ related node [[wonder me]]

⥅ related node [[wong kar wai]]

⥅ related node [[wordle es]]

⥅ related node [[wordle]]

⥅ related node [[wordnik]]

⥅ related node [[work after work]]

⥅ related node [[work in progress]]

⥅ related node [[work in public]]

⥅ related node [[work log]]

⥅ related node [[work work]]

⥅ related node [[work]]

⥅ related node [[worked]]

⥅ related node [[working in public]]

⥅ related node [[working]]

⥅ related node [[workitect]]

⥅ related node [[world building]]

⥅ related node [[world happiness foundation]]

⥅ related node [[world improvement]]

⥅ related node [[world university and school]]

⥅ related node [[world s hardest game]]

⥅ related node [[world]]

⥅ related node [[worldbrain]]

⥅ related node [[wormholes]]

⥅ related node [[worry dream]]

⥅ related node [[worrydream]]

⥅ related node [[would you agree]]

⥅ related node [[would you like to play?]]

⥅ related node [[wp]]

⥅ related node [[wptools]]

⥅ related node [[write freely]]

⥅ related node [[write]]

⥅ related node [[writer]]

⥅ related node [[writing is an aid to memory]]

⥅ related node [[writing pomodoro]]

⥅ related node [[writing while i write]]

⥅ related node [[writing while writing]]

⥅ related node [[writing while you write]]

⥅ related node [[writing with confidence]]

⥅ related node [[wtf happened in 1971]]

⥅ related node [[wu ming]]

⥅ related node [[wuas]]

⥅ related node [[wus]]

⥅ related node [[wuxga]]

⥅ related node [[www thetakemachine co uk]]

⥅ related node [[x frame options]]

⥅ related node [[x frame]]

⥅ related node [[x l]]

⥅ related node [[x spreadsheet]]

⥅ related node [[x with y]]

⥅ related node [[xanadu]]

⥅ related node [[xaos]]

⥅ related node [[xavivives]]

⥅ related node [[xin0]]

⥅ related node [[xinran zhu]]

⥅ related node [[xiq]]

⥅ related node [[xmpp]]

⥅ related node [[xoogler sre]]

⥅ related node [[xoogler table]]

⥅ related node [[xoxo]]

⥅ related node [[yakomo]]

⥅ related node [[yaldabaoth]]

⥅ related node [[yaml]]

⥅ related node [[yancey strickler]]

⥅ related node [[yann lecun]]

⥅ related node [[yarn]]

⥅ related node [[yatharth]]

⥅ related node [[year 2000]]

⥅ related node [[years]]

⥅ related node [[yemen]]

⥅ related node [[yemenis]]

⥅ related node [[yes]]

⥅ related node [[yi jian mei]]

⥅ related node [[yiction]]

⥅ related node [[yiming]]

⥅ related node [[yoga 11]]

⥅ related node [[yoga 13]]

⥅ related node [[yoga 15]]

⥅ related node [[yoga 17]]

⥅ related node [[yoga 2021 09]]

⥅ related node [[yoga 2021 10]]

⥅ related node [[yoga arrive]]

⥅ related node [[yoga arrivr]]

⥅ related node [[yoga breath]]

⥅ related node [[yoga butt kicking]]

⥅ related node [[yoga calendar]]

⥅ related node [[yoga december]]

⥅ related node [[yoga for abs]]

⥅ related node [[yoga for chefs]]

⥅ related node [[yoga for the future]]

⥅ related node [[yoga january 2022]]

⥅ related node [[yoga over the internet]]

⥅ related node [[yoga september 2021]]

⥅ related node [[yoga september]]

⥅ related node [[yoga spinal health]]

⥅ related node [[yoga with adriene]]

⥅ related node [[yoga with x story]]

⥅ related node [[yoga with x]]

⥅ related node [[yoga]]

⥅ related node [[yogi]]

⥅ related node [[yogthos]]

⥅ related node [[yotam ottolenghi]]

⥅ related node [[you and me together will vanquish moloch]]

⥅ related node [[you can run a flancian in your laptop]]

⥅ related node [[you can run an agora in your laptop]]

⥅ related node [[you see moloch]]

⥅ related node [[you will see me tonight]]

⥅ related node [[you]]

⥅ related node [[youbots]]

⥅ related node [[young wizards]]

⥅ related node [[your flancia]]

⥅ related node [[youronlyone]]

⥅ related node [[youtube channel]]

⥅ related node [[yt dlp]]

⥅ related node [[yubnub]]

⥅ related node [[yuval noah harari]]

⥅ related node [[ywa]]

⥅ related node [[ywx]]

⥅ related node [[zamyatin]]

⥅ related node [[zapier]]

⥅ related node [[zazen]]

⥅ related node [[zebras unite capital]]

⥅ related node [[zeitgeist movement]]

⥅ related node [[zelazny]]

⥅ related node [[zen in the art of archery]]

⥅ related node [[zen mind beginner s mind]]

⥅ related node [[zeno of elea]]

⥅ related node [[zeno s paradoxes]]

⥅ related node [[zeno]]

⥅ related node [[zergling]]

⥅ related node [[zero]]

⥅ related node [[zeta mask yo]]

⥅ related node [[zettelkasten id]]

⥅ related node [[zhdk]]

⥅ related node [[zhuangzi]]

⥅ related node [[zicklag]]

⥅ related node [[zidisha]]

⥅ related node [[zigzag]]

⥅ related node [[zine]]

⥅ related node [[zk]]

⥅ related node [[zo]]

⥅ related node [[zooglers]]

⥅ related node [[zooko wilcox]]

⥅ related node [[zoom games]]

⥅ related node [[zorro]]

⥅ related node [[zotero connector]]

⥅ related node [[zotero]]

⥅ related node [[zulip matrix bridge]]

⥅ related node [[zulip]]

⥅ related node [[zurich underground railway]]

⥅ related node [[zurich]]

⥅ related node [[ágora]]

⥅ related node [[époisses]]

⥅ related node [[öcalan]]

⥅ related node [[αγρός]]

⥅ related node [[πόλις]]

⥅ related node [[दृष्टि]]

⥅ related node [[2012 04 22 dungeons dragons alignment]]

⥅ related node [[2018 09 13 notes the first 20 hours]]

⥅ related node [[2018 11 15 mindbender]]

⥅ related node [[2018 11 24 paperclips in you]]

⥅ related node [[2019 02 18 cat gif steganography]]

⥅ related node [[2019 04 11 i did it]]

⥅ related node [[2019 06 03 techno]]

⥅ related node [[2019 06 14 new gods]]

⥅ related node [[2019 07 14 i know shit all]]

⥅ related node [[2019 07 17 panic attack]]

⥅ related node [[2019 11 08 propagation now]]

⥅ related node [[2019 11 28 haunted saunter]]

⥅ related node [[2020 01 02 my monstrosities]]

⥅ related node [[2020 01 07 loves fertilizer]]

⥅ related node [[2020 01 08 dont apologize to me]]

⥅ related node [[2020 01 15 why guess passwords md]]

⥅ related node [[2020 01 19 seize]]

⥅ related node [[2020 01 21 goodhart]]

⥅ related node [[2020 01 31 selection]]

⥅ related node [[2020 02 14 idontneedyou]]

⥅ related node [[2020 06 16 notes havamal]]

⥅ related node [[2020 06 26 atomic habits as ooda loop]]

⥅ related node [[2020 07 02 notes the battle with abarga sensen manghadai]]

⥅ related node [[2020 07 10 notes beowulf the setup]]

⥅ related node [[2020 07 24 catalepscene]]

⥅ related node [[2020 07 29 beowulf monsters glory]]

⥅ related node [[2020 07 31 ooda loops and mindfulness]]

⥅ related node [[2020 08 07 notes raghuvamsa song1]]

⥅ related node [[2020 08 14 notes rhaguvamsa song2]]

⥅ related node [[2020 08 17 pith walk in a copse]]

⥅ related node [[2020 12 01 secret history i]]

⥅ related node [[2021 02 03 pith posthuman]]

⥅ related node [[2021 02 19 mongooses and snakes]]

⥅ related node [[2021 02 20 hobbs and shaw and nietzsche]]

⥅ related node [[2021 02 21 egregores and you]]

⥅ related node [[2021 02 25 polytheism alive in baldurs gate]]

⥅ related node [[2021 03 06 neets are our fremen]]

⥅ related node [[2021 03 23 pp brooke]]

⥅ related node [[2021 03 29 pp emma]]

⥅ related node [[2021 04 10 pith radicalized]]

⥅ related node [[2021 08 01 pith crossed creek]]

⥅ related node [[2021 08 15 pith you me marcus aurelius]]

⥅ related node [[2021 08 24 leadership not exit]]

⥅ related node [[2021 08 26 the gift of shade]]

⥅ related node [[2021 09 27 witches priests everyday spirituality]]

⥅ related node [[2021 09 29 pith toes]]

⥅ related node [[2021 10 02 stand hand in hand]]

⥅ related node [[2021 10 10 pith what clothes you give us]]

⥅ related node [[2021 10 10 pp liminal]]

⥅ related node [[2021 10 28 notes secret history ii]]

⥅ related node [[2021 10 29 notes secret history iii]]

⥅ related node [[2021 10 7 uncertainty stress spirituality]]

⥅ related node [[2021 12 30 notes secret history iv]]

⥅ related node [[2022 04 09 twilight]]

⥅ related node [[2022 04 18 uncertainty stress spirituality ii]]

⥅ related node [[2022 06 16 notes secret history v]]

⥅ related node [[2022 08 01 notes creating magic]]

⥅ related node [[2023 03 01 what is rote repetition for]]

⥅ related node [[2023 03 02 pith you are a person]]

⥅ related node [[2023 03 10 how to mentor yourself]]

⥅ related node [[2023 03 21 what is the best martial art to learn]]

⥅ related node [[2023 08 15 manners masquerade]]

⥅ related node [[2023 09 19 cal jones 1]]

⥅ related node [[2023 09 25 collective brains for teams]]

⥅ related node [[2023 09 26 cal jones 2]]

⥅ related node [[2023 09 27 gi vs nogi]]

⥅ related node [[2023 09 28 cal jones 3]]

⥅ related node [[2023 10 10 cal jones 4]]

⥅ related node [[2023 11 26 dilution]]

⥅ related node [[2024 08 14 heartburn]]

⥅ related node [[2024 11 02 mentor yourself with claude]]

⥅ related node [[2025 04 05 sunny]]

⥅ related node [[2025 04 26 oil gas software infrastructure]]

⥅ related node [[2025 10 29 transparent armies]]

⥅ related node [[baldurs_gate_attacked]]

⥅ related node [[baldurs_gate_bucolic]]

⥅ related node [[baldurs_gate_opening]]

⥅ related node [[baldurs_gate_pantheism]]

⥅ related node [[baldurs_gate_sarevok]]

⥅ related node [[baldurs_gate_welcome_candlekeep]]

⥅ related node [[beigecanvas]]

⥅ related node [[benson_doctrine]]

⥅ related node [[bone_pattern]]

⥅ related node [[framework_corporate_political_action]]

⥅ related node [[hobbs_shaw_nietzsche_1]]

⥅ related node [[hobbs_shaw_nietzsche_2]]

⥅ related node [[hobbs_shaw_nietzsche_3]]

⥅ related node [[hobbs_shaw_nietzsche_4]]

⥅ related node [[kathy_sierra_badass_users]]

⥅ related node [[moon_knight]]

⥅ related node [[pp_brooke_carcrash]]

⥅ related node [[pp_brooke_icecream]]

⥅ related node [[precision_target]]

⥅ related node [[rebus_anarchic_brain]]

⥅ related node [[simler_personhood_comic]]

⥅ related node [[this_retard]]

⥅ related node [[yaopey yong penang]]

⥅ related node [[2024 07 23]]

⥅ related node [[cycles]]

⥅ related node [[energy]]

⥅ related node [[groups]]

⥅ related node [[2021 10 05]]

⥅ related node [[2021 10 11]]

⥅ related node [[2021 10 26]]

⥅ related node [[2021 11 29]]

⥅ related node [[2022 03 30]]

⥅ related node [[2022 04 23]]

⥅ related node [[2022 05 03]]

⥅ related node [[2022 10 20]]

⥅ related node [[2023 02 15]]

⥅ related node [[2023 02 16]]

⥅ related node [[2023 03 30]]

⥅ related node [[2023 04 18]]

⥅ related node [[2023 04 20]]

⥅ related node [[2023 04 24]]

⥅ related node [[2023 04 25]]

⥅ related node [[2023 05 05]]

⥅ related node [[2023 05 06]]

⥅ related node [[2023 05 16]]

⥅ related node [[2023 05 18]]

⥅ related node [[2023 05 24]]

⥅ related node [[2023 06 02]]

⥅ related node [[2023 06 06]]

⥅ related node [[2023 09 08]]

⥅ related node [[2023 09 19]]

⥅ related node [[2023 09 28]]

⥅ related node [[2023 10 10]]

⥅ related node [[2023 10 12]]

⥅ related node [[2023 10 31]]

⥅ related node [[2023 11 01]]

⥅ related node [[2023 11 03]]

⥅ related node [[2023 11 04]]

⥅ related node [[2024 01 28]]

⥅ related node [[live action battle arena]]

⥅ related node [[birds]]

⥅ related node [[children]]

⥅ related node [[copywriting swipefile]]

⥅ related node [[direction]]

⥅ related node [[elites]]

⥅ related node [[emotional energy]]

⥅ related node [[fear]]

⥅ related node [[fire support]]

⥅ related node [[generosity]]

⥅ related node [[gray tribe]]

⥅ related node [[homo ludens]]

⥅ related node [[hooked model]]

⥅ related node [[innovative group]]

⥅ related node [[leadership]]

⥅ related node [[mattis]]

⥅ related node [[mimetic rivalry]]

⥅ related node [[multicellular]]

⥅ related node [[organization]]

⥅ related node [[pete blaber]]

⥅ related node [[polgar]]

⥅ related node [[punishment]]

⥅ related node [[relationships]]

⥅ related node [[search and seizure]]

⥅ related node [[shigeru miyamoto]]

⥅ related node [[stalking]]

⥅ related node [[success]]

⥅ related node [[swarm]]

⥅ related node [[teams]]

⥅ related node [[theory of constraints]]

⥅ related node [[trust]]

⥅ related node [[unarmed]]

⥅ related node [[vilhjalmur stefansson]]

⥅ related node [[want]]

⥅ related node [[war]]

⥅ related node [[wind]]

⥅ related node [[power]]

⥅ related node [[quantum computing]]

⥅ related node [[resources]]

⥅ related node [[speech]]

⥅ related node [[raydoraisamy_favicon]]

⥅ related node [[2013]]

⥅ related node [[2021 06 21 16 14 50]]

⥅ related node [[2021 06 22 18 06 48]]

⥅ related node [[2021 06 22 18 07 42]]

⥅ related node [[2021 06 22 18 12 30]]

⥅ related node [[2021 06 22 18 18 06]]

⥅ related node [[2021 06 22 18 22 15]]

⥅ related node [[2021 06 22 18 29 04]]

⥅ related node [[2021 06 22 18 31 01]]

⥅ related node [[2021 06 22 18 33 08]]

⥅ related node [[2021 06 22 18 34 05]]

⥅ related node [[2021 06 22 18 34 39]]

⥅ related node [[2021 06 22 18 34 53]]

⥅ related node [[2021 06 22 18 37 30]]

⥅ related node [[2021 06 22 18 39 06]]

⥅ related node [[2021 06 22 18 39 19]]

⥅ related node [[2021 06 22 18 40 06]]

⥅ related node [[2021 06 22 18 41 27]]

⥅ related node [[2021 06 22 18 43 17]]

⥅ related node [[2021 06 22 18 44 29]]

⥅ related node [[2021 06 22 18 47 03]]

⥅ related node [[2021 06 22 18 47 59]]

⥅ related node [[2021 06 22 18 48 58]]

⥅ related node [[2021 06 22 18 49 13]]

⥅ related node [[2021 06 22 18 50 38]]

⥅ related node [[2021 06 22 18 50 58]]

⥅ related node [[2021 06 22 18 51 21]]

⥅ related node [[2021 06 22 18 52 23]]

⥅ related node [[2021 06 22 18 57 05]]

⥅ related node [[2021 06 22 18 57 40]]

⥅ related node [[2021 06 22 18 57 53]]

⥅ related node [[2021 06 22 18 59 37]]

⥅ related node [[2021 06 22 19 00 29]]

⥅ related node [[2021 06 22 19 01 08]]

⥅ related node [[2021 06 22 19 02 12]]

⥅ related node [[2021 06 22 19 03 38]]

⥅ related node [[2021 06 22 19 04 03]]

⥅ related node [[2021 06 22 19 05 35]]

⥅ related node [[2021 06 22 19 05 57]]

⥅ related node [[2021 06 22 19 06 15]]

⥅ related node [[2021 06 22 19 08 03]]

⥅ related node [[2021 06 22 19 09 20]]

⥅ related node [[2021 06 22 19 09 46]]

⥅ related node [[2021 06 22 19 10 43]]

⥅ related node [[2021 06 22 19 11 18]]

⥅ related node [[2021 06 22 19 14 56]]

⥅ related node [[2021 06 22 19 16 27]]

⥅ related node [[2021 06 22 19 16 47]]

⥅ related node [[2021 06 22 19 18 46]]

⥅ related node [[2021 06 22 19 22 20]]

⥅ related node [[2021 06 22 19 30 16]]

⥅ related node [[2021 06 24 20 05 56]]

⥅ related node [[2021 06 24 20 07 38]]

⥅ related node [[2021 06 24 20 11 06]]

⥅ related node [[2021 06 24 20 12 12]]

⥅ related node [[2021 06 24 20 12 40]]

⥅ related node [[2021 06 24 20 13 23]]

⥅ related node [[2021 06 24 20 14 05]]

⥅ related node [[2021 06 24 20 17 33]]

⥅ related node [[2021 06 24 20 23 02]]

⥅ related node [[2021 06 24 20 23 25]]

⥅ related node [[2021 06 24 20 23 54]]

⥅ related node [[2021 06 24 20 25 04]]

⥅ related node [[2021 06 24 20 26 16]]

⥅ related node [[2021 06 24 20 32 07]]

⥅ related node [[2021 06 24 20 38 40]]

⥅ related node [[2021 06 25 07 18 45]]

⥅ related node [[2021 06 25 16 06 37]]

⥅ related node [[2021 06 25 16 11 31]]

⥅ related node [[2021 06 25 19 38 55]]

⥅ related node [[2021 07 28 18 13 33]]

⥅ related node [[2021 07 28 18 14 20]]

⥅ related node [[2021 07 28 18 17 55]]

⥅ related node [[2021 07 28 18 18 19]]

⥅ related node [[2021 07 28 18 19 42]]

⥅ related node [[2021 07 28 18 20 46]]

⥅ related node [[2021 07 28 18 21 20]]

⥅ related node [[2021 07 28 18 21 46]]

⥅ related node [[2021 07 28 18 22 12]]

⥅ related node [[2021 07 28 18 22 49]]

⥅ related node [[2021 07 28 18 24 08]]

⥅ related node [[2021 07 28 18 25 24]]

⥅ related node [[2021 07 28 18 25 51]]

⥅ related node [[2021 07 28 18 26 09]]

⥅ related node [[2021 07 28 18 26 27]]

⥅ related node [[2021 07 28 18 28 33]]

⥅ related node [[2021 07 28 18 36 46]]

⥅ related node [[2021 07 28 18 40 08]]

⥅ related node [[2021 07 28 18 42 39]]

⥅ related node [[2021 07 28 18 43 54]]

⥅ related node [[2021 07 28 18 45 46]]

⥅ related node [[2021 07 28 18 46 54]]

⥅ related node [[2021 07 28 18 47 35]]

⥅ related node [[2021 07 28 18 48 06]]

⥅ related node [[2021 07 28 18 48 19]]

⥅ related node [[2021 07 28 18 49 07]]

⥅ related node [[2021 07 28 18 49 21]]

⥅ related node [[2021 07 28 18 50 33]]

⥅ related node [[2021 07 28 18 51 31]]

⥅ related node [[2021 07 28 18 51 56]]

⥅ related node [[2021 07 28 18 54 00]]

⥅ related node [[2021 07 28 18 54 53]]

⥅ related node [[2021 07 28 18 59 30]]

⥅ related node [[2021 07 28 19 00 30]]

⥅ related node [[2021 07 28 19 00 59]]

⥅ related node [[2021 07 28 19 16 28]]

⥅ related node [[2021 07 28 19 16 52]]

⥅ related node [[2021 07 28 19 25 51]]

⥅ related node [[2021 07 28 19 32 02]]

⥅ related node [[2021 07 28 19 33 38]]

⥅ related node [[2021 07 28 19 35 26]]

⥅ related node [[2021 07 28 19 43 11]]

⥅ related node [[2021 07 28 19 43 24]]

⥅ related node [[2021 07 28 19 43 48]]

⥅ related node [[2021 07 28 19 44 27]]

⥅ related node [[daily notes]]

⥅ related node [[graph visualization]]

⥅ related node [[link reference definitions]]

⥅ related node [[note properties]]

⥅ related node [[note templates]]

⥅ related node [[spell checking]]

⥅ related node [[tags and tag explorer]]

⥅ related node [[wiki links]]

⥅ related node [[get started with vscode]]

⥅ related node [[paste images from clipboard]]

⥅ related node [[use keyboard shortcuts for editing]]

⥅ related node [[write notes in foam]]

⥅ related node [[fot 2021 06 25]]

⥅ related node [[ftfi 2021 07 28]]

⥅ related node [[getting started]]

⥅ related node [[i annotate 2021 dan whaley]]

⥅ related node [[iannotate2021thu]]

⥅ related node [[iannotate2021tuesday]]

⥅ related node [[a chinese]]

⥅ related node [[alexander technique]]

⥅ related node [[andy matuschak knowledge work showcase video]]

⥅ related node [[atomic habits]]

⥅ related node [[attention is cognitive unison]]

⥅ related node [[awakening from the meaning crisis]]

⥅ related node [[banana bread]]

⥅ related node [[book review secular cycles]]

⥅ related node [[branding]]

⥅ related node [[breakfast scones]]

⥅ related node [[concrete book club idea]]

⥅ related node [[e ad hoc book clubs]]

⥅ related node [[e automatic mailing list for incremental brainstorming]]

⥅ related node [[e better note taking can be taught interactively]]

⥅ related node [[e incremental brainstorming]]

⥅ related node [[e learning platform for independent course creators]]

⥅ related node [[e naming concepts like a hook]]

⥅ related node [[e textbook design for learning]]

⥅ related node [[e the goal of learning should be producing]]

⥅ related node [[how i learned 1500 chinese characters in a month heisig method review]]

⥅ related node [[just in time project management]]

⥅ related node [[knowledge compressor]]

⥅ related node [[learning math with iversity]]

⥅ related node [[nat eliason s roam course]]

⥅ related node [[note taking]]

⥅ related node [[pace layers]]

⥅ related node [[podcast interview with stephen kosslyn about minerva]]

⥅ related node [[podcast with doug tataryn on deconstructing yourself]]

⥅ related node [[podcast with john vervaeke on future thinkers]]

⥅ related node [[podcast with tiago forte and david perell on education]]

⥅ related node [[project fluid]]

⥅ related node [[remembering simplified hanzi]]

⥅ related node [[retro concept]]

⥅ related node [[sapiens📒]]

⥅ related node [[technology of stian s notes]]

⥅ related node [[the body keeps the score]]

⥅ related node [[the elephant in the brain📒]]

⥅ related node [[three levels of note taking]]

⥅ related node [[transfer of learning from a modern multidisciplinary perspective]]

⥅ related node [[background]]

⥅ related node [[logo]]

⥅ related node [[2022 12 02]]

⥅ related node [[2025 05 24]]

⥅ related node [[2025 05 27]]

⥅ related node [[2025 06 05]]

⥅ related node [[2025 06 11]]

⥅ related node [[2025 06 24]]

⥅ related node [[2025 07 09]]

⥅ related node [[2025 08 14]]

⥅ related node [[2025 08 20]]

⥅ related node [[2025 08 22]]

⥅ related node [[2025 10 17]]

⥅ related node [[2025 10 29]]

⥅ related node [[a fresh new morning has dawned]]

⥅ related node [[agroecology]]

⥅ related node [[anova ovf 02 2022]]

⥅ related node [[author as producer]]

⥅ related node [[big bang]]

⥅ related node [[blood meridian]]

⥅ related node [[canasta básica]]

⥅ related node [[chance love and logic]]

⥅ related node [[clerk]]

⥅ related node [[convivial tools]]

⥅ related node [[curso de filosofía de la música]]

⥅ related node [[discrimination in digital finance]]

⥅ related node [[dunbars number is quadratic]]

⥅ related node [[duolingo]]

⥅ related node [[errico malatesta]]

⥅ related node [[especifismo]]

⥅ related node [[esperanto]]

⥅ related node [[essays on suffering focused ethics]]

⥅ related node [[gift economy]]

⥅ related node [[gpt 4 summary]]

⥅ related node [[hyperstition]]

⥅ related node [[late bloomer]]

⥅ related node [[liberatory technology]]

⥅ related node [[lojban]]

⥅ related node [[means and ends]]

⥅ related node [[objects conceive other objects in capitalism]]

⥅ related node [[oda escrita en 1966]]

⥅ related node [[oops is the sound we make]]

⥅ related node [[pedagogy of the oppressed]]

⥅ related node [[platform capitalism]]

⥅ related node [[platformism]]

⥅ related node [[reads]]

⥅ related node [[resignify fedposting]]

⥅ related node [[salutation the second]]

⥅ related node [[sound and symbol]]

⥅ related node [[survival of the fittest in romantic terms]]

⥅ related node [[technopoly]]

⥅ related node [[the communism of the rheinischer beobachter]]

⥅ related node [[the matrix]]

⥅ related node [[the philosophy of improvisation]]

⥅ related node [[venezuela]]

⥅ related node [[when the internet puts the brackets on]]

⥅ related node [[ética nicomáquea]]

⥅ related node [[arch notes nov 7]]

⥅ related node [[shoe]]

⥅ related node [[2021 06 08]]

⥅ related node [[2021 07 26]]

⥅ related node [[2021 08 21]]

⥅ related node [[2021 08 22]]

⥅ related node [[2021 08 23]]

⥅ related node [[2021 09 03]]

⥅ related node [[2021 11 15]]

⥅ related node [[2021 11 17]]

⥅ related node [[2022 01 05]]

⥅ related node [[2022 04 14]]

⥅ related node [[2022 04 22]]

⥅ related node [[2022 12 13]]

⥅ related node [[2023 01 08]]

⥅ related node [[2023 01 19]]

⥅ related node [[2023 02 22]]

⥅ related node [[2023 03 26]]

⥅ related node [[2023 04 05]]

⥅ related node [[2023 04 13]]

⥅ related node [[2023 04 14]]

⥅ related node [[2023 04 19]]

⥅ related node [[2023 04 22]]

⥅ related node [[2023 04 23]]

⥅ related node [[2023 04 26]]

⥅ related node [[2023 05 21]]

⥅ related node [[2023 05 29]]

⥅ related node [[2023 06 09]]

⥅ related node [[2023 06 28]]

⥅ related node [[2023 06 29]]

⥅ related node [[2023 07 01]]

⥅ related node [[2023 07 02]]

⥅ related node [[2023 07 09]]

⥅ related node [[2023 07 10]]

⥅ related node [[2023 07 11]]

⥅ related node [[2023 07 21]]

⥅ related node [[2023 08 04]]

⥅ related node [[2023 08 08]]

⥅ related node [[2023 09 05]]

⥅ related node [[2023 09 12]]

⥅ related node [[2023 09 13]]

⥅ related node [[2023 09 14]]

⥅ related node [[2023 09 16]]

⥅ related node [[2023 09 22]]

⥅ related node [[2023 10 08]]

⥅ related node [[2023 10 18]]

⥅ related node [[2023 10 20]]

⥅ related node [[2023 10 23]]

⥅ related node [[2023 10 24]]

⥅ related node [[2023 10 25]]

⥅ related node [[2023 10 27]]

⥅ related node [[2023 10 28]]

⥅ related node [[2023 10 29]]

⥅ related node [[2023 10 30]]

⥅ related node [[20211129152900 local_first_software]]

⥅ related node [[academia]]

⥅ related node [[acl2]]

⥅ related node [[advice]]

⥅ related node [[assembly]]

⥅ related node [[biology]]

⥅ related node [[bodymod]]

⥅ related node [[building a computer]]

⥅ related node [[cambria]]

⥅ related node [[camera]]

⥅ related node [[choosing_a_college]]

⥅ related node [[clothing]]

⥅ related node [[compilers]]

⥅ related node [[config image previews]]

⥅ related node [[contentedness]]

⥅ related node [[cooking]]

⥅ related node [[coop experience abroad]]

⥅ related node [[css]]

⥅ related node [[dont_do_it_later]]

⥅ related node [[emacs]]

⥅ related node [[employment]]

⥅ related node [[entreprenuership]]

⥅ related node [[erlang]]

⥅ related node [[ethical web]]

⥅ related node [[evaluating cities]]

⥅ related node [[exercise]]

⥅ related node [[exwm]]

⥅ related node [[fitness]]

⥅ related node [[floating point]]

⥅ related node [[formal spec languages]]

⥅ related node [[furniture]]

⥅ related node [[fuzzers]]

⥅ related node [[game dev]]

⥅ related node [[hackathon]]

⥅ related node [[health]]

⥅ related node [[homelab]]

⥅ related node [[impact]]

⥅ related node [[interior design]]

⥅ related node [[joss]]

⥅ related node [[keyboard]]

⥅ related node [[language]]

⥅ related node [[latency_matters]]

⥅ related node [[linux]]

⥅ related node [[longform computer texts]]

⥅ related node [[longterm]]

⥅ related node [[macros are expressions of freedom]]

⥅ related node [[mail]]

⥅ related node [[memoriam]]

⥅ related node [[memory safety]]

⥅ related node [[messaging]]

⥅ related node [[metaprogramming]]

⥅ related node [[mobile]]

⥅ related node [[modern_suppliers]]

⥅ related node [[moving_to_boston]]

⥅ related node [[mtg]]

⥅ related node [[networking]]

⥅ related node [[nix]]

⥅ related node [[nixos_installation]]

⥅ related node [[org_mode]]

⥅ related node [[os]]

⥅ related node [[posix]]

⥅ related node [[prob stat]]

⥅ related node [[programming languages]]

⥅ related node [[psych]]

⥅ related node [[public]]

⥅ related node [[python]]

⥅ related node [[quantified self]]

⥅ related node [[quotes]]

⥅ related node [[racket]]

⥅ related node [[react]]

⥅ related node [[shaving]]

⥅ related node [[shows]]

⥅ related node [[sieve]]

⥅ related node [[smess]]

⥅ related node [[smt]]

⥅ related node [[static analysis]]

⥅ related node [[strong types weak types]]

⥅ related node [[sweden todo]]

⥅ related node [[talks]]

⥅ related node [[taste]]

⥅ related node [[text editors]]

⥅ related node [[theoremprover]]

⥅ related node [[tour of berlin]]

⥅ related node [[urweb]]

⥅ related node [[vim]]

⥅ related node [[web]]

⥅ related node [[web_design]]

⥅ related node [[wm]]

⥅ related node [[you and your research]]

⥅ related node [[about me]]

⥅ related node [[agora node aliasing]]

⥅ related node [[agora user perspective]]

⥅ related node [[all advice is autobiographical]]

⥅ related node [[2022 01 16 1]]

⥅ related node [[fehérlófia_1]]

⥅ related node [[header1]]

⥅ related node [[leftvalues_2022 01 16]]

⥅ related node [[nlm nlmuid 101437065 img]]

⥅ related node [[brazil]]

⥅ related node [[canonical meta]]

⥅ related node [[chìjiǎo yīshēng]]

⥅ related node [[clarice lispector]]

⥅ related node [[compositionality is composability without emergence]]

⥅ related node [[dialogism]]

⥅ related node [[digital gardener taxonomy]]

⥅ related node [[errance]]

⥅ related node [[fehérlófia]]

⥅ related node [[gambiarra]]

⥅ related node [[horizontalism vs verticalism]]

⥅ related node [[inserting wikilinks into quotes]]

⥅ related node [[interface]]

⥅ related node [[jayu eleuthéria]]

⥅ related node [[2022 02 04]]

⥅ related node [[leftvalues]]

⥅ related node [[máo zédōng]]

⥅ related node [[neorg]]

⥅ related node [[node club tarot 2022 02 06]]

⥅ related node [[node club tarot]]

⥅ related node [[pluriverse]]

⥅ related node [[polyphony]]

⥅ related node [[ricing]]

⥅ related node [[shared context]]

⥅ related node [[teia dos povos]]

⥅ related node [[tecnophobia]]

⥅ related node [[activities with cards]]

⥅ related node [[alejandro jodorowsky]]

⥅ related node [[andrey tarkovsky]]

⥅ related node [[anki]]

⥅ related node [[applications of automata theory and algebra]]

⥅ related node [[applied utopia and constructive optimism]]

⥅ related node [[benno kaschner russo]]

⥅ related node [[cognitive artifacts]]

⥅ related node [[das vollkommene leben]]

⥅ related node [[gilles deleuze]]

⥅ related node [[gusto gräzer]]

⥅ related node [[literary machines]]

⥅ related node [[michael hampe]]

⥅ related node [[mini curriculum on applied category theory and engineering design]]

⥅ related node [[mtr]]

⥅ related node [[omnitopia]]

⥅ related node [[pattern language for thinking in groups]]

⥅ related node [[patterning reading group report]]

⥅ related node [[things that help me with sleep]]

⥅ related node [[utopia studies]]

⥅ related node [[android misc]]

⥅ related node [[android]]

⥅ related node [[biology misc]]

⥅ related node [[human body]]

⥅ related node [[blog]]

⥅ related node [[static blog]]

⥅ related node [[4 hour body]]

⥅ related node [[log]]

⥅ related node [[prog 21 century]]

⥅ related node [[computing]]

⥅ related node [[food misc]]

⥅ related node [[nutrition]]

⥅ related node [[sleep]]

⥅ related node [[exports]]

⥅ related node [[file_sync]]

⥅ related node [[infra]]

⥅ related node [[personal assistant]]

⥅ related node [[webarchive]]

⥅ related node [[differential forms]]

⥅ related node [[games theory]]

⥅ related node [[math misc]]

⥅ related node [[reprtheory]]

⥅ related node [[synthetic topology]]

⥅ related node [[eeg]]

⥅ related node [[misc]]

⥅ related node [[travel]]

⥅ related node [[music theory]]

⥅ related node [[astronomy]]

⥅ related node [[classical mechanics]]

⥅ related node [[cosmology]]

⥅ related node [[fun with lagrangians]]

⥅ related node [[gauge invariance]]

⥅ related node [[general relativity]]

⥅ related node [[physics misc]]

⥅ related node [[physics papers]]

⥅ related node [[physics]]

⥅ related node [[qft]]

⥅ related node [[quantum gravity]]

⥅ related node [[quantum]]

⥅ related node [[relativity]]

⥅ related node [[symplectic]]

⥅ related node [[orgmode]]

⥅ related node [[spacedrep]]

⥅ related node [[prepping]]

⥅ related node [[agda]]

⥅ related node [[androiddev]]

⥅ related node [[bash]]

⥅ related node [[elisp sucks]]

⥅ related node [[elisp]]

⥅ related node [[fp]]

⥅ related node [[literate]]

⥅ related node [[programming misc]]

⥅ related node [[best practices]]

⥅ related node [[error handling]]

⥅ related node [[python_as_shell]]

⥅ related node [[python_is_good]]

⥅ related node [[python_tricks]]

⥅ related node [[typing]]

⥅ related node [[refile]]

⥅ related node [[webdev]]

⥅ related node [[webext]]

⥅ related node [[axol]]

⥅ related node [[bleanser]]

⥅ related node [[cachew]]

⥅ related node [[cloudmacs]]

⥅ related node [[dashboard]]

⥅ related node [[dron]]

⥅ related node [[ext]]

⥅ related node [[fgroup]]

⥅ related node [[grasp]]

⥅ related node [[orger]]

⥅ related node [[qs misc]]

⥅ related node [[qs]]

⥅ related node [[sleep tracking]]

⥅ related node [[reading]]

⥅ related node [[decentralization]]

⥅ related node [[dictation]]

⥅ related node [[shell]]

⥅ related node [[study misc]]

⥅ related node [[tostudy]]

⥅ related node [[summary]]

⥅ related node [[think]]

⥅ related node [[toread]]

⥅ related node [[vr]]

⥅ related node [[3cs 3es 4is]]

⥅ related node [[a beautiful wiki page]]

⥅ related node [[a new narrative]]

⥅ related node [[a stony story]]

⥅ related node [[a tale of poo]]

⥅ related node [[a walled city]]

⥅ related node [[a way forward]]

⥅ related node [[about ipbsm]]

⥅ related node [[about kerry]]

⥅ related node [[about transport plugin]]

⥅ related node [[accountancy]]

⥅ related node [[admission]]

⥅ related node [[adverse childhood events]]

⥅ related node [[advocating systems thinking]]

⥅ related node [[age of aquarius]]

⥅ related node [[age of pisces]]

⥅ related node [[agile mindset]]

⥅ related node [[agile practices]]

⥅ related node [[all strings attached]]

⥅ related node [[another tale of poo]]

⥅ related node [[assessing systems thinking capacity]]

⥅ related node [[avoiding the void]]

⥅ related node [[be whiched]]

⥅ related node [[beauty good truth and economy]]

⥅ related node [[begin from nothing]]

⥅ related node [[being the spark]]

⥅ related node [[body mood mind spirit]]

⥅ related node [[brain storm]]

⥅ related node [[building out maps]]

⥅ related node [[bullying]]

⥅ related node [[causal loop diagramming]]

⥅ related node [[cauzality]]

⥅ related node [[change]]

⥅ related node [[charter for compassion]]

⥅ related node [[circles are sacred]]

⥅ related node [[circles in the air]]

⥅ related node [[climate change loops]]

⥅ related node [[climate change]]

⥅ related node [[colours of life]]

⥅ related node [[commitment is beautiful]]

⥅ related node [[company vs business]]

⥅ related node [[compassionate systems]]

⥅ related node [[complexity simplicity]]

⥅ related node [[complexity weekend]]

⥅ related node [[composting]]

⥅ related node [[contents page]]

⥅ related node [[conversations brainstorm]]

⥅ related node [[covid dynamics]]

⥅ related node [[create new page]]

⥅ related node [[creation]]

⥅ related node [[creativity and fear]]

⥅ related node [[critical conversation types]]

⥅ related node [[crushed]]

⥅ related node [[curiosity]]

⥅ related node [[dads and daughters]]

⥅ related node [[dear client]]

⥅ related node [[degrowth conference]]

⥅ related node [[dependence on machines]]

⥅ related node [[depression or hibernation]]

⥅ related node [[design thinking]]

⥅ related node [[designed ingenuity dig]]

⥅ related node [[designing interventions]]

⥅ related node [[df cf interventions]]

⥅ related node [[disability and dependence]]

⥅ related node [[do it naturally]]

⥅ related node [[document management]]

⥅ related node [[dominoes experience]]

⥅ related node [[dont stand out]]

⥅ related node [[dpm questions]]

⥅ related node [[ecopolicy game]]

⥅ related node [[education]]

⥅ related node [[embracing uniqueness]]

⥅ related node [[emotions and colours]]

⥅ related node [[emperors new clothes]]

⥅ related node [[engagement vs commitment]]

⥅ related node [[engaging in education]]

⥅ related node [[epic poetry savitri]]

⥅ related node [[epic poetry tao]]

⥅ related node [[equestrian art]]

⥅ related node [[eric]]

⥅ related node [[ethical non monogamy]]

⥅ related node [[ethical regulator design]]

⥅ related node [[ethical systems]]

⥅ related node [[excavating the past]]

⥅ related node [[exeter experience]]

⥅ related node [[exploring ethical systems]]

⥅ related node [[expression of interest]]

⥅ related node [[falling fences]]

⥅ related node [[faqs for clds]]

⥅ related node [[fatal attraction]]

⥅ related node [[fear and learning]]

⥅ related node [[federation search]]

⥅ related node [[feeling you]]

⥅ related node [[fell pony heritage centre]]

⥅ related node [[feminine masculine energy]]

⥅ related node [[feynman on systems]]

⥅ related node [[first time right]]

⥅ related node [[fishing games]]

⥅ related node [[five women]]

⥅ related node [[floating in systems]]

⥅ related node [[flux]]

⥅ related node [[four nested questions]]

⥅ related node [[from regurgitation to discovery]]

⥅ related node [[full steam ahead]]

⥅ related node [[gary moore]]

⥅ related node [[genwise course curriculum]]

⥅ related node [[graphs 1st cohort]]

⥅ related node [[graphviz]]

⥅ related node [[great leap backwards]]

⥅ related node [[great teachers]]

⥅ related node [[grenfell tower]]

⥅ related node [[guineapigs]]

⥅ related node [[haiku wiki]]

⥅ related node [[half halt]]

⥅ related node [[happiness circles]]

⥅ related node [[healthy food]]

⥅ related node [[heavy metal]]

⥅ related node [[helping hoof for fells]]

⥅ related node [[holistic organisation]]

⥅ related node [[hospital beds]]

⥅ related node [[how government is rigged]]

⥅ related node [[how to get rid of your friends]]

⥅ related node [[how to raise your parents]]

⥅ related node [[i offer my hand]]

⥅ related node [[iceberg model]]

⥅ related node [[ician or ist]]

⥅ related node [[identify b loop]]

⥅ related node [[identify r loop]]

⥅ related node [[imagineering education]]

⥅ related node [[in the beginning]]

⥅ related node [[index of supplements]]

⥅ related node [[ingreedients]]

⥅ related node [[introduction to conversations]]

⥅ related node [[inventing governing]]

⥅ related node [[isss conference 2021]]

⥅ related node [[jail break]]

⥅ related node [[jay forrester]]

⥅ related node [[joan of arc]]

⥅ related node [[john david garcia]]

⥅ related node [[keeper]]

⥅ related node [[kerry marc collaboration]]

⥅ related node [[kerry marcs backlog list]]

⥅ related node [[kerrys curriculum vitae]]

⥅ related node [[kerrys poetry]]

⥅ related node [[kids mind maps]]

⥅ related node [[kidz in biz]]

⥅ related node [[knowing you]]

⥅ related node [[krishnamurti on education]]

⥅ related node [[learning cycles]]

⥅ related node [[learning from ochs]]

⥅ related node [[learning graphviz]]

⥅ related node [[learning to use fedwiki]]

⥅ related node [[learning to wait]]

⥅ related node [[learning vs blaming]]

⥅ related node [[let it go]]

⥅ related node [[lets explore virtues]]

⥅ related node [[life after lancaster]]

⥅ related node [[life cycle]]

⥅ related node [[light housed]]

⥅ related node [[lines in the mind]]

⥅ related node [[local self education]]

⥅ related node [[love intelligence]]

⥅ related node [[loves s curve]]

⥅ related node [[lune du la]]

⥅ related node [[make believe]]

⥅ related node [[making light]]

⥅ related node [[making steam]]

⥅ related node [[man kind]]

⥅ related node [[map the system]]

⥅ related node [[march notes kerry marc]]

⥅ related node [[martian on earth]]

⥅ related node [[maths of love]]

⥅ related node [[meaningful fulfilling employment]]

⥅ related node [[measuring child wellbeing]]

⥅ related node [[memory test]]

⥅ related node [[menage a trois]]

⥅ related node [[micks model]]

⥅ related node [[mindwalk]]

⥅ related node [[model of models]]

⥅ related node [[mood]]

⥅ related node [[morin on education for the future]]

⥅ related node [[moto gps]]

⥅ related node [[movement matters]]

⥅ related node [[musics heartbeat]]

⥅ related node [[my childhood]]

⥅ related node [[my funny way of thinking]]

⥅ related node [[my invisible lover]]

⥅ related node [[negative school impact]]

⥅ related node [[nobody stopped]]

⥅ related node [[non systems thinking]]

⥅ related node [[notes between kerry marc]]

⥅ related node [[observations day 3]]

⥅ related node [[observations sys 1]]

⥅ related node [[observations sys 2]]

⥅ related node [[ochs bridge systems]]

⥅ related node [[ochs learning cohort1]]

⥅ related node [[ochs sys 1]]

⥅ related node [[ochs sys 2]]

⥅ related node [[ochs sys 3]]

⥅ related node [[ochs sys 4]]

⥅ related node [[ochs sys 5]]

⥅ related node [[ochs sys 6]]

⥅ related node [[ochs sys 7]]

⥅ related node [[on full power]]

⥅ related node [[on machines men]]

⥅ related node [[outside the box]]

⥅ related node [[paddingtons dominoes]]

⥅ related node [[panas 10 survey]]

⥅ related node [[panas 10]]

⥅ related node [[panas 5 negative affect]]

⥅ related node [[panas 5 positive affect]]

⥅ related node [[paper folding experience]]

⥅ related node [[paper people]]

⥅ related node [[paradise retrieved]]

⥅ related node [[parental fear impact]]

⥅ related node [[passage to india]]

⥅ related node [[peaks and troughs]]

⥅ related node [[people like us]]

⥅ related node [[perfect partners]]

⥅ related node [[persist or resist]]

⥅ related node [[perspectives exercises]]

⥅ related node [[playing games]]

⥅ related node [[playing to win]]

⥅ related node [[plight]]

⥅ related node [[positive to negative affect in learning environments]]

⥅ related node [[positivity scores and ratio]]

⥅ related node [[power of exponential]]

⥅ related node [[power of nothing]]

⥅ related node [[power of purchasing]]

⥅ related node [[power of purpose]]

⥅ related node [[power of sharing]]

⥅ related node [[power of unity]]

⥅ related node [[prison song]]

⥅ related node [[process thinking]]

⥅ related node [[professional dig]]

⥅ related node [[psalm of truth]]

⥅ related node [[pull the plug]]

⥅ related node [[punch and judy]]

⥅ related node [[radar chart]]

⥅ related node [[recent changes]]

⥅ related node [[relationships exercise]]

⥅ related node [[resilience]]

⥅ related node [[richard the lionheart]]

⥅ related node [[riding dynamics]]

⥅ related node [[riding high]]

⥅ related node [[rock star]]

⥅ related node [[sailing story variables]]

⥅ related node [[sailing with rob b]]

⥅ related node [[salience network]]

⥅ related node [[satisfy your curiosity ]]

⥅ related node [[saving tamtam]]

⥅ related node [[scrum]]

⥅ related node [[secret dream world]]

⥅ related node [[see the system]]

⥅ related node [[see the systems for airbus]]

⥅ related node [[see the systems partners]]

⥅ related node [[see the systems process]]

⥅ related node [[seeds of love]]

⥅ related node [[seeing and believing]]

⥅ related node [[shantie]]

⥅ related node [[she swallowed a fly]]

⥅ related node [[slave to love]]

⥅ related node [[slow syntegration]]

⥅ related node [[small things big difference]]

⥅ related node [[st ebbes dig]]

⥅ related node [[st2050]]

⥅ related node [[stars]]

⥅ related node [[step 1]]

⥅ related node [[step 2]]

⥅ related node [[step 3]]

⥅ related node [[step 4]]

⥅ related node [[step 5]]

⥅ related node [[step 6]]

⥅ related node [[step 7]]

⥅ related node [[step 8]]

⥅ related node [[step 9]]

⥅ related node [[stop being smart]]

⥅ related node [[story of stories]]

⥅ related node [[strength and suppleness]]

⥅ related node [[systems and creatvity]]

⥅ related node [[systems and wholeness]]

⥅ related node [[systems certification]]

⥅ related node [[systems education research]]

⥅ related node [[systems societies]]

⥅ related node [[systems thinking in schools research]]

⥅ related node [[systems thinking resource list]]

⥅ related node [[systems thinking]]

⥅ related node [[take any two]]

⥅ related node [[tale of two pigs]]

⥅ related node [[teachers and pupils]]

⥅ related node [[tears for fears]]

⥅ related node [[teenagers mind maps]]

⥅ related node [[test graph]]

⥅ related node [[test table]]

⥅ related node [[the 4is]]

⥅ related node [[the actor]]

⥅ related node [[the buzzard]]

⥅ related node [[the dark]]

⥅ related node [[the dayton experiment index]]

⥅ related node [[the dayton practice]]

⥅ related node [[the experiencer]]

⥅ related node [[the fisherman]]

⥅ related node [[the gardener]]

⥅ related node [[the gravestone]]

⥅ related node [[the great she cession]]

⥅ related node [[the holos project]]

⥅ related node [[the hundred languages]]

⥅ related node [[the i and the we]]

⥅ related node [[the lens grinder]]

⥅ related node [[the light]]

⥅ related node [[the lionheart ride]]

⥅ related node [[the loner]]

⥅ related node [[the magic number five]]

⥅ related node [[the magpie]]

⥅ related node [[the modern trivium]]

⥅ related node [[the new corporation]]

⥅ related node [[the peach]]

⥅ related node [[the process in big steps]]

⥅ related node [[the school in the cloud]]

⥅ related node [[the second child]]

⥅ related node [[the trees]]

⥅ related node [[theodore melnechuk]]

⥅ related node [[things to read]]

⥅ related node [[thinking differently]]

⥅ related node [[tommys story chapter1]]

⥅ related node [[tommys story chapter10]]

⥅ related node [[tommys story chapter2]]

⥅ related node [[tommys story chapter3]]

⥅ related node [[tommys story chapter4]]

⥅ related node [[tommys story chapter5]]

⥅ related node [[tommys story chapter6]]

⥅ related node [[tommys story chapter7]]

⥅ related node [[tommys story chapter8]]

⥅ related node [[tommys story chapter9]]

⥅ related node [[tommys story workbook]]

⥅ related node [[tommys story]]

⥅ related node [[towards a human society of trust and truth a 2120 vision]]

⥅ related node [[tragedy and trust]]

⥅ related node [[trialectical synthesis]]

⥅ related node [[turning rocks]]

⥅ related node [[two flowers]]

⥅ related node [[un sustainable development goals]]

⥅ related node [[unintended consequences]]

⥅ related node [[unleashing genius dig]]

⥅ related node [[variables experience]]

⥅ related node [[vitality in systems]]

⥅ related node [[wandering]]

⥅ related node [[welcome visitors]]

⥅ related node [[what am i]]

⥅ related node [[what if]]

⥅ related node [[what is god]]

⥅ related node [[what is love]]

⥅ related node [[whole mind]]

⥅ related node [[wholeness in systems]]

⥅ related node [[why map a system]]

⥅ related node [[wilder child]]

⥅ related node [[wombwell women]]

⥅ related node [[woolman proposals]]

⥅ related node [[words for relationships]]

⥅ related node [[words music pictures]]

⥅ related node [[writing about equines]]

⥅ related node [[your cat]]

⥅ related node [[agile business analyst role]]

⥅ related node [[aws practictioner certification]]

⥅ related node [[certification resources]]

⥅ related node [[linkedin agile training cert level 1]]

⥅ related node [[the agile manifesto]]

⥅ related node [[the four values of agile]]

⥅ related node [[the scrum guide]]

⥅ related node [[adding to the training corpus]]

⥅ related node [[alternatives to chatterbot hugginface]]

⥅ related node [[chatterbot training corpus]]

⥅ related node [[ibm watson assistant can be text or voice]]

⥅ related node [[implementing chatterbot as a cog for brook]]

⥅ related node [[main library chatterbot]]

⥅ related node [[main library hugginface]]

⥅ related node [[the chatterbot documentation]]

⥅ related node [[the ubuntu training corpus]]

⥅ related node [[why i didn t use chatterbot]]

⥅ related node [[computer vision main file]]

⥅ related node [[applications of computer vision]]

⥅ related node [[brainstorming computer vision application ideas]]

⥅ related node [[computer vision week 1 main file]]

⥅ related node [[fairness in ai diversity in faces dataset]]

⥅ related node [[image classification]]

⥅ related node [[introduction to computer vision]]

⥅ related node [[recent research in computer vision]]

⥅ related node [[computer vision week 2 main file]]

⥅ related node [[ibm watson visual recognition api]]

⥅ related node [[computer vision week 3 main file]]

⥅ related node [[image compression and quantisation with k means clustering]]

⥅ related node [[image processing with opencv (code)]]

⥅ related node [[object detection with haar classifiers]]

⥅ related node [[object detection with opencv]]

⥅ related node [[python and opencv]]

⥅ related node [[computer vision week 4 main file]]

⥅ related node [[advanced context variables]]

⥅ related node [[amazon alexa]]

⥅ related node [[api details for the flower shop assistant]]

⥅ related node [[building ai powered chatbots with watson]]

⥅ related node [[certification build ai powered chatbots without programming (ibm)]]

⥅ related node [[child dialogue nodes]]

⥅ related node [[context variables and slots]]

⥅ related node [[deploying a chatbot to wordpress]]

⥅ related node [[dialogues]]

⥅ related node [[digressions]]

⥅ related node [[dummy wordpress site credentials]]

⥅ related node [[fallback child node]]

⥅ related node [[get to know the analytics tab]]

⥅ related node [[google dialogflow]]

⥅ related node [[how to build a chatbot with watson assistant]]

⥅ related node [[ibm conversational computation]]

⥅ related node [[ibm notes on chatbot writing]]

⥅ related node [[implementing dialogues]]

⥅ related node [[introduction to chatbots]]

⥅ related node [[master slots]]

⥅ related node [[nine criteraia for evaluating chatbot vendors]]

⥅ related node [[preparing a chatbot for deployment]]

⥅ related node [[seven most important conversational computing providers]]

⥅ related node [[the first chatbot eliza]]

⥅ related node [[what are chatbots]]

⥅ related node [[data ai ml pipeline creation links]]

⥅ related node [[accessibie language guidelines]]

⥅ related node [[chatbot personality]]

⥅ related node [[conversation design]]

⥅ related node [[feminist chatbot main page]]

⥅ related node [[feminist goals when creating bots]]

⥅ related node [[feminist internet]]

⥅ related node [[fxa and chatbot railroading]]

⥅ related node [[fxa and the use of i by bots]]

⥅ related node [[gender in conversational systems]]

⥅ related node [[josie s bot ethics framework]]

⥅ related node [[owning bothood in chatbot conversation]]

⥅ related node [[personality civo]]

⥅ related node [[response to how is feminist conversation design different ]]

⥅ related node [[civo chatbot script design]]

⥅ related node [[stakeholders vs users]]

⥅ related node [[floria storyboard]]

⥅ related node [[storyboard change]]

⥅ related node [[storyboard considerations]]

⥅ related node [[storyboarding character]]

⥅ related node [[storyboarding interaction]]

⥅ related node [[storyboarding main page]]

⥅ related node [[storyboarding scene]]

⥅ related node [[storyboarding trigger]]

⥅ related node [[testing iot bots for feminism]]

⥅ related node [[the challenge of conversation design]]

⥅ related node [[1 stakeholders]]

⥅ related node [[2 purpose]]

⥅ related node [[3 context]]

⥅ related node [[4 bias]]

⥅ related node [[5 design and representation]]

⥅ related node [[6 conversation design]]

⥅ related node [[7 data]]

⥅ related node [[8 architecture]]

⥅ related node [[the feminist design tool]]

⥅ related node [[the role of the conversation designer]]

⥅ related node [[user research]]

⥅ related node [[whimsical chat designer]]

⥅ related node [[eleutherai main page]]

⥅ related node [[nlp citations for the pile ]]

⥅ related node [[nlp citations instructions]]

⥅ related node [[ai service deployment main page]]

⥅ related node [[creating a discovery collection]]

⥅ related node [[data vs insight]]

⥅ related node [[week 1 main page]]

⥅ related node [[advanced watson discovery]]

⥅ related node [[week 2 watson discovery]]

⥅ related node [[creating a watson chatbot with discovery]]

⥅ related node [[integrating discovery and assistant]]

⥅ related node [[adding watson speech services]]

⥅ related node [[voice options for your chatbot]]

⥅ related node [[deploying your watson assistant to facebook messenger]]

⥅ related node [[deploying your watson assistant to slack]]

⥅ related node [[deployment options for watson speech assistant]]

⥅ related node [[idea ai link related as you type]]

⥅ related node [[idea ai pattern idea journo matching]]

⥅ related node [[idea_ai ai enabled point cameras collecting traffic clangers]]

⥅ related node [[idea_ai customised sports commentary]]

⥅ related node [[idea_ai nlp powered meta content creation]]

⥅ related node [[ideas for newsrooms (list)]]

⥅ related node [[ai and the time to be creative]]

⥅ related node [[ai in the media key questions to consider]]

⥅ related node [[ai is not magic demystify and apply]]

⥅ related node [[ai needs barriers to be successful]]

⥅ related node [[ai requires buy in from leadership]]

⥅ related node [[ai s ratchet effect]]

⥅ related node [[ai specific pain points]]

⥅ related node [[an ai initiative s success relies on measurability]]

⥅ related node [[comparison of not having an ai plan in 2020]]

⥅ related node [[diversity lowers the risk of ai]]

⥅ related node [[examples and impact of ai (list)]]

⥅ related node [[expert insights ai fast forwards video for sports highlights]]

⥅ related node [[find an ai mentor]]

⥅ related node [[get to ai at scale]]

⥅ related node [[historyofai]]

⥅ related node [[introducing ai]]

⥅ related node [[prioritisation]]

⥅ related node [[prove the value of ai]]

⥅ related node [[pwc study ai s impact on gdp by 2030]]

⥅ related node [[tanmay s journey and take on ai]]

⥅ related node [[the 3 foundations (ai) is only as good as your (ia)]]

⥅ related node [[the ai job replacement axiom]]

⥅ related node [[the ai ladder]]

⥅ related node [[the next 10 000 business cases kevin kelly]]

⥅ related node [[time proportion value increase of the journalist]]

⥅ related node [[two key elements of ai componentry and process]]

⥅ related node [[week 1 introduction]]

⥅ related node [[what is ai]]

⥅ related node [[women leaders in ai]]

⥅ related node [[activation function]]

⥅ related node [[adaptive resonance theory]]

⥅ related node [[adoption starts with education]]

⥅ related node [[applications for the three types of machine learning]]

⥅ related node [[back propagation]]

⥅ related node [[best practice ai lessons from early adopters]]

⥅ related node [[biological comparisons]]

⥅ related node [[build deploy or collaborate]]

⥅ related node [[checklist for ai adoption]]

⥅ related node [[classification supervised learning]]

⥅ related node [[cnns convolutional neural networks]]

⥅ related node [[deep learning in nlp]]

⥅ related node [[deep learning]]

⥅ related node [[four main categories of ai implementation]]

⥅ related node [[four stages of human cognition]]

⥅ related node [[functional patterns]]

⥅ related node [[goal based patterns]]

⥅ related node [[hidden layers]]

⥅ related node [[how to get started with cognitive technology]]

⥅ related node [[ibm s cognitive advantage global market report]]

⥅ related node [[k means clustering]]

⥅ related node [[long short term memory lstm]]

⥅ related node [[modern approaches in nlp]]

⥅ related node [[natural language processing]]

⥅ related node [[neural networks]]

⥅ related node [[perceptron learning]]

⥅ related node [[perceptrons]]

⥅ related node [[project debater understanding each other through ai]]

⥅ related node [[q learning]]

⥅ related node [[quote the numbers benefits of ai adoption]]

⥅ related node [[recurrent neural networks in nlp]]

⥅ related node [[regression supervised learning]]

⥅ related node [[reinforcement supervised learning]]

⥅ related node [[reinforcement learning in nlp]]

⥅ related node [[rnns recurrent neural networks]]

⥅ related node [[supervised learning]]

⥅ related node [[technology patterns]]

⥅ related node [[the testing set]]

⥅ related node [[the three patterns of ai technology usage]]

⥅ related node [[the training set]]

⥅ related node [[the validation set]]

⥅ related node [[three ways to evaluate models]]

⥅ related node [[training your model]]

⥅ related node [[unsupervised learning]]

⥅ related node [[week 2 introduction]]

⥅ related node [[woodside ai causes growth in jobs]]

⥅ related node [[ai and differentiation free vs paywalled content]]

⥅ related node [[ai and regaining market share]]

⥅ related node [[ai is polysemous accumulates meanings]]

⥅ related node [[ai is here most unaware]]

⥅ related node [[ai will purify the use of journalistic skills]]

⥅ related node [[autogeneration of news content]]

⥅ related node [[beware when using traditional messaging theory around ai]]

⥅ related node [[bots for comments moderation]]

⥅ related node [[bots for news content]]

⥅ related node [[can journalists and ai cooperate or is it war]]

⥅ related node [[collating meta content with ai]]

⥅ related node [[creatives have already been replaced in places]]

⥅ related node [[creativity buffering jobs from ai takeover]]

⥅ related node [[current uses of natural language generated content]]

⥅ related node [[a b_testing]]

⥅ related node [[accuracy]]

⥅ related node [[active learning]]

⥅ related node [[adagrad]]

⥅ related node [[agent]]

⥅ related node [[agglomerative_clustering]]

⥅ related node [[ai glossary]]

⥅ related node [[ar]]

⥅ related node [[area_under_the_pr_curve]]

⥅ related node [[area_under_the_roc_curve]]

⥅ related node [[artificial_general_intelligence]]

⥅ related node [[artificial_intelligence]]

⥅ related node [[attention mechanism]]

⥅ related node [[attribute]]

⥅ related node [[auc_(area_under_the_roc_curve)]]

⥅ related node [[augmented_reality]]

⥅ related node [[automation_bias]]

⥅ related node [[average_precision]]

⥅ related node [[backpropagation]]

⥅ related node [[bag_of_words]]

⥅ related node [[baseline]]

⥅ related node [[batch]]

⥅ related node [[batch_normalization]]

⥅ related node [[batch_size]]

⥅ related node [[bayesian_neural_network]]

⥅ related node [[bellman_equation]]

⥅ related node [[bias_(ethics fairness)]]

⥅ related node [[bias_(math)]]

⥅ related node [[binary_classification]]

⥅ related node [[boosting]]

⥅ related node [[bounding_box]]

⥅ related node [[broadcasting]]

⥅ related node [[bucketing]]

⥅ related node [[calibration_layer]]

⥅ related node [[candidate_generation]]

⥅ related node [[candidate_sampling]]

⥅ related node [[categorical_data]]

⥅ related node [[centroid based_clustering]]

⥅ related node [[centroid]]

⥅ related node [[checkpoint]]

⥅ related node [[class imbalanced_dataset]]

⥅ related node [[class]]

⥅ related node [[classification_model]]

⥅ related node [[classification_threshold]]

⥅ related node [[clipping]]

⥅ related node [[cloud_tpu]]

⥅ related node [[clustering]]

⥅ related node [[co adaptation]]

⥅ related node [[collaborative_filtering]]

⥅ related node [[confirmation_bias]]

⥅ related node [[confusion_matrix]]

⥅ related node [[continuous_feature]]

⥅ related node [[convenience_sampling]]

⥅ related node [[convex_function]]

⥅ related node [[convex_optimization]]

⥅ related node [[convex_set]]

⥅ related node [[convolution]]

⥅ related node [[convolutional_filter]]

⥅ related node [[convolutional_layer]]

⥅ related node [[convolutional_neural_network]]

⥅ related node [[convolutional_operation]]

⥅ related node [[cost]]

⥅ related node [[counterfactual_fairness]]

⥅ related node [[coverage_bias]]

⥅ related node [[crash_blossom]]

⥅ related node [[critic]]

⥅ related node [[cross entropy]]

⥅ related node [[cross validation]]

⥅ related node [[custom_estimator]]

⥅ related node [[data_analysis]]

⥅ related node [[data_augmentation]]

⥅ related node [[data_set_or_dataset]]

⥅ related node [[dataframe]]

⥅ related node [[dataset_api_(tf data)]]

⥅ related node [[decision_boundary]]

⥅ related node [[decision_threshold]]

⥅ related node [[decision_tree]]

⥅ related node [[deep_model]]

⥅ related node [[deep_neural_network]]

⥅ related node [[deep_q network_(dqn)]]

⥅ related node [[demographic_parity]]

⥅ related node [[dense_feature]]

⥅ related node [[dense_layer]]

⥅ related node [[depth]]

⥅ related node [[depthwise_separable_convolutional_neural_network_(sepcnn)]]

⥅ related node [[device]]

⥅ related node [[dimension_reduction]]

⥅ related node [[dimensions]]

⥅ related node [[discrete_feature]]

⥅ related node [[discriminative_model]]

⥅ related node [[discriminator]]

⥅ related node [[disparate_impact]]

⥅ related node [[disparate_treatment]]

⥅ related node [[divisive_clustering]]

⥅ related node [[downsampling]]

⥅ related node [[dqn]]

⥅ related node [[dynamic_model]]

⥅ related node [[eager_execution]]

⥅ related node [[early_stopping]]

⥅ related node [[embedding_space]]

⥅ related node [[embeddings]]

⥅ related node [[empirical_risk_minimization_(erm)]]

⥅ related node [[ensemble]]

⥅ related node [[environment]]

⥅ related node [[episode]]

⥅ related node [[epoch]]

⥅ related node [[epsilon_greedy_policy]]

⥅ related node [[equality_of_opportunity]]

⥅ related node [[equalized_odds]]

⥅ related node [[estimator]]

⥅ related node [[example]]

⥅ related node [[experience_replay]]

⥅ related node [[experimenter s_bias]]

⥅ related node [[exploding_gradient_problem]]

⥅ related node [[fairness_constraint]]

⥅ related node [[fairness_metric]]

⥅ related node [[false_negative_(fn)]]

⥅ related node [[false_positive_(fp)]]

⥅ related node [[false_positive_rate_(fpr)]]

⥅ related node [[feature]]

⥅ related node [[feature_column_(tf feature_column)]]

⥅ related node [[feature_cross]]

⥅ related node [[feature_engineering]]

⥅ related node [[feature_extraction]]

⥅ related node [[feature_set]]

⥅ related node [[feature_spec]]

⥅ related node [[feature_vector]]

⥅ related node [[federated_learning]]

⥅ related node [[feedback_loop]]

⥅ related node [[feedforward_neural_network_(ffn)]]

⥅ related node [[few shot_learning]]

⥅ related node [[fine_tuning]]

⥅ related node [[forget_gate]]

⥅ related node [[full_softmax]]

⥅ related node [[fully_connected_layer]]

⥅ related node [[gan]]

⥅ related node [[gated recurrent unit]]

⥅ related node [[generalization]]

⥅ related node [[generalization_curve]]

⥅ related node [[generalized_linear_model]]

⥅ related node [[generative_adversarial_network_(gan)]]

⥅ related node [[generative_model]]

⥅ related node [[generator]]

⥅ related node [[gradient]]

⥅ related node [[gradient_clipping]]

⥅ related node [[gradient_descent]]

⥅ related node [[graph_execution]]

⥅ related node [[greedy_policy]]

⥅ related node [[ground_truth]]

⥅ related node [[group_attribution_bias]]

⥅ related node [[hashing]]

⥅ related node [[heuristic]]

⥅ related node [[hidden_layer]]

⥅ related node [[hierarchical_clustering]]

⥅ related node [[hinge_loss]]

⥅ related node [[holdout_data]]

⥅ related node [[hyperparameter]]

⥅ related node [[hyperplane]]

⥅ related node [[i i d ]]

⥅ related node [[image_recognition]]

⥅ related node [[imbalanced_dataset]]

⥅ related node [[implicit_bias]]

⥅ related node [[in group_bias]]

⥅ related node [[incompatibility_of_fairness_metrics]]

⥅ related node [[independently_and_identically_distributed_(i i d)]]

⥅ related node [[individual_fairness]]

⥅ related node [[inference]]

⥅ related node [[input_function]]

⥅ related node [[input_layer]]

⥅ related node [[inter rater_agreement]]

⥅ related node [[interpretability]]

⥅ related node [[intersection_over_union_(iou)]]

⥅ related node [[iou]]

⥅ related node [[item_matrix]]

⥅ related node [[items]]

⥅ related node [[iteration]]

⥅ related node [[k means]]

⥅ related node [[k median]]

⥅ related node [[keras]]

⥅ related node [[kernel_support_vector_machines_(ksvms)]]

⥅ related node [[keypoints]]

⥅ related node [[l1_loss]]

⥅ related node [[l1_regularization]]

⥅ related node [[l2_loss]]

⥅ related node [[l2_regularization]]

⥅ related node [[label]]

⥅ related node [[labeled_example]]

⥅ related node [[lambda]]

⥅ related node [[landmarks]]

⥅ related node [[layer]]

⥅ related node [[layers_api_(tf layers)]]

⥅ related node [[learning_rate]]

⥅ related node [[least_squares_regression]]

⥅ related node [[linear_model]]

⥅ related node [[linear_regression]]

⥅ related node [[log odds]]

⥅ related node [[log_loss]]

⥅ related node [[logistic_regression]]

⥅ related node [[logits]]

⥅ related node [[long_short term_memory_(lstm)]]

⥅ related node [[loss]]

⥅ related node [[loss_curve]]

⥅ related node [[loss_surface]]

⥅ related node [[lstm]]

⥅ related node [[machine_learning]]

⥅ related node [[majority_class]]

⥅ related node [[markov_property]]

⥅ related node [[matplotlib]]

⥅ related node [[matrix_factorization]]

⥅ related node [[mean_absolute_error_(mae)]]

⥅ related node [[mean_squared_error_(mse)]]

⥅ related node [[metric]]

⥅ related node [[metrics_api_(tf metrics)]]

⥅ related node [[mini batch]]

⥅ related node [[mini batch_stochastic_gradient_descent_(sgd)]]

⥅ related node [[minimax_loss]]

⥅ related node [[minority_class]]

⥅ related node [[ml]]

⥅ related node [[mnist]]

⥅ related node [[model]]

⥅ related node [[model_capacity]]

⥅ related node [[model_function]]

⥅ related node [[model_training]]

⥅ related node [[momentum]]

⥅ related node [[multi class_classification]]

⥅ related node [[multi class_logistic_regression]]

⥅ related node [[multinomial_classification]]

⥅ related node [[n gram]]

⥅ related node [[nan_trap]]

⥅ related node [[natural language understanding]]

⥅ related node [[negative_class]]

⥅ related node [[neural_network]]

⥅ related node [[nlu]]

⥅ related node [[node_(neural_network)]]

⥅ related node [[node_(tensorflow_graph)]]

⥅ related node [[noise]]

⥅ related node [[non response_bias]]

⥅ related node [[normalization]]

⥅ related node [[numerical_data]]

⥅ related node [[numpy]]

⥅ related node [[objective]]

⥅ related node [[objective_function]]

⥅ related node [[offline_inference]]

⥅ related node [[one hot_encoding]]

⥅ related node [[one shot_learning]]

⥅ related node [[one vs all]]

⥅ related node [[online_inference]]

⥅ related node [[operation_(op)]]

⥅ related node [[optimizer]]

⥅ related node [[out group_homogeneity_bias]]

⥅ related node [[outliers]]

⥅ related node [[output_layer]]

⥅ related node [[pandas]]

⥅ related node [[parameter]]

⥅ related node [[parameter_server_(ps)]]

⥅ related node [[parameter_update]]

⥅ related node [[partial_derivative]]

⥅ related node [[participation_bias]]

⥅ related node [[partitioning_strategy]]

⥅ related node [[perceptron]]

⥅ related node [[performance]]

⥅ related node [[perplexity]]

⥅ related node [[pipeline]]

⥅ related node [[policy]]

⥅ related node [[polysemous]]

⥅ related node [[pooling]]

⥅ related node [[positive_class]]

⥅ related node [[post processing]]

⥅ related node [[pr_auc_(area_under_the_pr_curve)]]

⥅ related node [[pre trained_model]]

⥅ related node [[precision recall_curve]]

⥅ related node [[precision]]

⥅ related node [[prediction]]

⥅ related node [[prediction_bias]]

⥅ related node [[predictive_parity]]

⥅ related node [[predictive_rate_parity]]

⥅ related node [[premade_estimator]]

⥅ related node [[preprocessing]]

⥅ related node [[prior_belief]]

⥅ related node [[proxy_(sensitive_attributes)]]

⥅ related node [[proxy_labels]]

⥅ related node [[q function]]

⥅ related node [[quantile]]

⥅ related node [[quantile_bucketing]]

⥅ related node [[quantization]]

⥅ related node [[random_forest]]

⥅ related node [[random_policy]]

⥅ related node [[rank_(ordinality)]]

⥅ related node [[rank_(tensor)]]

⥅ related node [[rater]]

⥅ related node [[re ranking]]

⥅ related node [[recall]]

⥅ related node [[recommendation_system]]

⥅ related node [[rectified_linear_unit_(relu)]]

⥅ related node [[recurrent_neural_network]]

⥅ related node [[regression_model]]

⥅ related node [[regularization]]

⥅ related node [[regularization_rate]]

⥅ related node [[reinforcement_learning_(rl)]]

⥅ related node [[replay_buffer]]

⥅ related node [[reporting_bias]]

⥅ related node [[representation]]

⥅ related node [[return]]

⥅ related node [[reward]]

⥅ related node [[ridge_regularization]]

⥅ related node [[rnn]]

⥅ related node [[roc_(receiver_operating_characteristic)_curve]]

⥅ related node [[root_directory]]

⥅ related node [[root_mean_squared_error_(rmse)]]

⥅ related node [[rotational_invariance]]

⥅ related node [[sampling_bias]]

⥅ related node [[savedmodel]]

⥅ related node [[saver]]

⥅ related node [[scalar]]

⥅ related node [[scaling]]

⥅ related node [[scikit learn]]

⥅ related node [[scoring]]

⥅ related node [[selection_bias]]

⥅ related node [[semi supervised_learning]]

⥅ related node [[sensitive_attribute]]

⥅ related node [[sentiment_analysis]]

⥅ related node [[sequence_model]]

⥅ related node [[serving]]

⥅ related node [[session_(tf session)]]

⥅ related node [[shape_(tensor)]]

⥅ related node [[sigmoid_function]]

⥅ related node [[similarity_measure]]

⥅ related node [[size_invariance]]

⥅ related node [[sketching]]

⥅ related node [[softmax]]

⥅ related node [[sparse_feature]]

⥅ related node [[sparse_representation]]

⥅ related node [[sparse_vector]]

⥅ related node [[sparsity]]

⥅ related node [[spatial_pooling]]

⥅ related node [[squared_hinge_loss]]

⥅ related node [[squared_loss]]

⥅ related node [[state action_value_function]]

⥅ related node [[state]]

⥅ related node [[static_model]]

⥅ related node [[stationarity]]

⥅ related node [[step]]

⥅ related node [[step_size]]

⥅ related node [[stochastic_gradient_descent_(sgd)]]

⥅ related node [[stride]]

⥅ related node [[structural_risk_minimization_(srm)]]

⥅ related node [[subsampling]]

⥅ related node [[synthetic_feature]]

⥅ related node [[tabular_q learning]]

⥅ related node [[target]]

⥅ related node [[target_network]]

⥅ related node [[temporal_data]]

⥅ related node [[tensor flow course master page]]

⥅ related node [[tensor]]

⥅ related node [[tensor_processing_unit_(tpu)]]

⥅ related node [[tensor_rank]]

⥅ related node [[tensor_shape]]

⥅ related node [[tensor_size]]

⥅ related node [[tensorboard]]

⥅ related node [[tensorflow]]

⥅ related node [[tensorflow_playground]]

⥅ related node [[tensorflow_serving]]

⥅ related node [[termination_condition]]

⥅ related node [[test_set]]

⥅ related node [[tf example]]

⥅ related node [[tf keras]]

⥅ related node [[time_series_analysis]]

⥅ related node [[timestep]]

⥅ related node [[tower]]

⥅ related node [[tpu]]

⥅ related node [[tpu_chip]]

⥅ related node [[tpu_device]]

⥅ related node [[tpu_master]]

⥅ related node [[tpu_node]]

⥅ related node [[tpu_pod]]

⥅ related node [[tpu_resource]]

⥅ related node [[tpu_slice]]

⥅ related node [[tpu_type]]

⥅ related node [[tpu_worker]]

⥅ related node [[training]]

⥅ related node [[training_set]]

⥅ related node [[trajectory]]

⥅ related node [[transfer_learning]]

⥅ related node [[translational_invariance]]

⥅ related node [[trigram]]

⥅ related node [[true_negative_(tn)]]

⥅ related node [[true_positive_(tp)]]

⥅ related node [[true_positive_rate_(tpr)]]

⥅ related node [[unawareness_(to_a_sensitive_attribute)]]

⥅ related node [[underfitting]]

⥅ related node [[unlabeled_example]]

⥅ related node [[unsupervised_machine_learning]]

⥅ related node [[upweighting]]

⥅ related node [[user_matrix]]

⥅ related node [[validation]]

⥅ related node [[validation_set]]

⥅ related node [[vanishing_gradient_problem]]

⥅ related node [[wasserstein_loss]]

⥅ related node [[weight]]

⥅ related node [[weighted_alternating_least_squares_(wals)]]

⥅ related node [[what we need next in ai kevin kelly]]

⥅ related node [[wide_model]]

⥅ related node [[width]]

⥅ related node [[editors resist fully automated news process]]

⥅ related node [[journalists jobs will have to change]]

⥅ related node [[natural language generation]]

⥅ related node [[news media industry changes caused by ai]]

⥅ related node [[news to audience relationship has changed over 20 years]]

⥅ related node [[opinions on ai replacing jobs]]

⥅ related node [[optimising the editorial work process with ai]]

⥅ related node [[origin stories of ai in news media and journalism]]

⥅ related node [[popularity of ai journalistic tools]]

⥅ related node [[questions of intellectual property ownership]]

⥅ related node [[recurring origin stories of ai]]

⥅ related node [[saad and issa s use of ai in journalism]]

⥅ related node [[sports fans and data chewing bots]]

⥅ related node [[tech has changed journo hiring priorities]]

⥅ related node [[the threat to journalists jobs]]

⥅ related node [[traditional journalism driving ai not ai driving journalism]]

⥅ related node [[translating worldwide news with ai]]

⥅ related node [[unsupervised neural networks for detecting fake news]]

⥅ related node [[week 3 introduction]]

⥅ related node [[ai won t look like humans kevin kelly]]

⥅ related node [[all business is data business kevin kelly]]

⥅ related node [[can an ai be creative]]

⥅ related node [[constraints on ai and robotic advances]]

⥅ related node [[job creation in an ai future]]

⥅ related node [[question what can ai do]]

⥅ related node [[the ladder of ai]]

⥅ related node [[theailadder]]

⥅ related node [[we just don t understand understanding]]

⥅ related node [[week 4 introduction]]

⥅ related node [[main ai page]]

⥅ related node [[professional_certificate_ _applied_ai]]

⥅ related node [[python_for_data_sci_and_ai_foundational]]

⥅ related node [[pasted image 20201103162748]]

⥅ related node [[pasted image]]

⥅ related node [[professional machine learning workstation exxact quote]]

⥅ related node [[recommended algorithms by usage]]

⥅ related node [[answering tomorrow s legal questions]]

⥅ related node [[ar powered technician support]]

⥅ related node [[claims assessed 25 per cent faster]]

⥅ related node [[confidence in the details]]

⥅ related node [[customer response in seconds not minutes]]

⥅ related node [[enriching customer service]]

⥅ related node [[expected ai spend next year (2021)]]

⥅ related node [[expert service 60 per cent faster]]

⥅ related node [[expertice on call]]

⥅ related node [[four key principles of watson]]

⥅ related node [[how ai amplifies an employee s role]]

⥅ related node [[how to get ibm on board]]

⥅ related node [[maintenance done 90 per cent faster]]

⥅ related node [[market data in plain language]]

⥅ related node [[module 1 watson ai overview]]

⥅ related node [[predicting and preventing breakdowns]]

⥅ related node [[preserving institutional wisdom]]

⥅ related node [[the business importance of recording interactions]]

⥅ related node [[transfer learning ibm]]

⥅ related node [[watson ai is changing how business is done]]

⥅ related node [[watson explorer]]

⥅ related node [[watson with audits and compliance]]

⥅ related node [[cloud services]]

⥅ related node [[data science]]

⥅ related node [[module 2 available watson services]]

⥅ related node [[watson availability]]

⥅ related node [[watson discovery]]

⥅ related node [[watson natural language understanding]]

⥅ related node [[watson speech to text]]

⥅ related node [[watson text to speech]]

⥅ related node [[big 5 personality model]]

⥅ related node [[computer vision its applications and ibm watson]]

⥅ related node [[module 3 advanced watson services]]

⥅ related node [[open source replacements todo]]

⥅ related node [[watson at liveperson contact centres]]

⥅ related node [[watson compare and comply]]

⥅ related node [[watson knowledge catalogue]]

⥅ related node [[watson machine learning]]

⥅ related node [[watson openscale]]

⥅ related node [[watson personality insights]]

⥅ related node [[watson studio]]

⥅ related node [[watson tone analyser]]

⥅ related node [[bradesco]]

⥅ related node [[module 4 watson use cases and resources list]]

⥅ related node [[toby watson s use cases]]

⥅ related node [[watson at adnoc]]

⥅ related node [[watson at hilton]]

⥅ related node [[watson at liveperson]]

⥅ related node [[watson at work]]

⥅ related node [[watson for oncology clinical trial matching and genomics]]

⥅ related node [[watson ibm use cases certification]]

⥅ related node [[watson in use at coca cola company]]

⥅ related node [[watson in use at kone]]

⥅ related node [[creative works vault guide]]

⥅ related node [[dnd tome of millie hide]]

⥅ related node [[the grimoire of love and war]]

⥅ related node [[newton s nightmare]]

⥅ related node [[poem an emperor s lamenting thanks]]

⥅ related node [[advanced regression analytics]]

⥅ related node [[analysing results]]

⥅ related node [[auto sales]]

⥅ related node [[binary regressions]]

⥅ related node [[building permits]]

⥅ related node [[china pmi]]

⥅ related node [[construction spending]]

⥅ related node [[consumer confidence]]

⥅ related node [[consumer price index (cpi)]]

⥅ related node [[ceda workplace inequality and gdp boost report]]

⥅ related node [[deloitte millennial survey]]

⥅ related node [[economic reports reading list]]

⥅ related node [[difference in differences analysis]]

⥅ related node [[direct and indirect risks]]

⥅ related node [[econometrics main page]]

⥅ related node [[economic forecasting methods]]

⥅ related node [[economic reports]]

⥅ related node [[economics main page]]

⥅ related node [[economics resources page]]

⥅ related node [[employment and jobs report]]

⥅ related node [[existing home sales]]

⥅ related node [[fed decisions and the dot plot]]

⥅ related node [[fed press conference and the testimony]]

⥅ related node [[financial risk management solution costs liquidity and volatility]]

⥅ related node [[financial risk management solution costs standardisation and time]]

⥅ related node [[financial risk management solutions]]

⥅ related node [[financial solutions futures and forwards]]

⥅ related node [[financial solutions interest rate swaps]]

⥅ related node [[financial solutions options]]

⥅ related node [[five financial corporate risks]]

⥅ related node [[fixed effects regressions]]

⥅ related node [[forecast accuracy]]

⥅ related node [[four nonfinancial corporate risks]]

⥅ related node [[gdp consumption]]

⥅ related node [[gdp governemnt spending]]

⥅ related node [[gdp investment]]

⥅ related node [[gdp net exports and trade]]

⥅ related node [[gdp regional fed estimates]]

⥅ related node [[gdp overview]]

⥅ related node [[gdp vs gnp]]

⥅ related node [[german ifo and eurozone pmi]]

⥅ related node [[economic_glossary]]

⥅ related node [[housing overall]]

⥅ related node [[housing starts]]

⥅ related node [[imf quarterly gdp forecasts]]

⥅ related node [[impact on central banks and markets]]

⥅ related node [[impact on jobs and professional opportunities]]

⥅ related node [[impact on sectors and companies]]

⥅ related node [[industrial production]]

⥅ related node [[inflation rates and yield curve]]

⥅ related node [[ism manufacturing index]]

⥅ related node [[ism nonmanufacturing index]]

⥅ related node [[jobless claims]]

⥅ related node [[leading indicators]]

⥅ related node [[alternatives to gdp for measuring wellbeing]]

⥅ related node [[economic indicators list]]

⥅ related node [[fundamentals of risk analysis]]

⥅ related node [[master list of economic reports with links]]

⥅ related node [[mba mortgage applications]]

⥅ related node [[monetary policy]]

⥅ related node [[new home sales]]

⥅ related node [[nonfinancial solutions]]

⥅ related node [[opec decisions]]

⥅ related node [[overview of financial market risks]]

⥅ related node [[pending home sales]]

⥅ related node [[personal consumption expenditures]]

⥅ related node [[predicting values with regression]]

⥅ related node [[producer price index]]

⥅ related node [[professionals in corporate risk management]]

⥅ related node [[pulling inflation measures together]]

⥅ related node [[quantitative and qualitative data collection for risk management]]

⥅ related node [[regional monthly manufacturing fed data]]

⥅ related node [[regresion analysis in economics]]

⥅ related node [[retail sales]]

⥅ related node [[risk management main page]]

⥅ related node [[s&p case shiller index]]

⥅ related node [[saar seasonally adjusted annual rate]]

⥅ related node [[scenario analysis]]

⥅ related node [[sector impacts on investments]]

⥅ related node [[serial correlation in data]]

⥅ related node [[small business private sector job contribution 2015]]

⥅ related node [[sources of economic data]]

⥅ related node [[the basics of economic ansalysis]]

⥅ related node [[the importance of economic reports]]

⥅ related node [[the importance of the risk management process]]

⥅ related node [[the risk management process]]

⥅ related node [[trend analysis in forecasting]]

⥅ related node [[understanding risk in corporations]]

⥅ related node [[use economic forecasts]]

⥅ related node [[weekly energy reports]]

⥅ related node [[what is fiscal policy]]

⥅ related node [[what is inflation]]

⥅ related node [[english_anaphylaxis]]

⥅ related node [[english_asthma]]

⥅ related node [[english_bat_bite]]

⥅ related node [[english_bites_and_stings]]

⥅ related node [[english_burn_or_scald]]

⥅ related node [[english_choking_adult]]

⥅ related node [[english_choking_infant]]

⥅ related node [[english_concussion]]

⥅ related node [[english_covid 19]]

⥅ related node [[english_cpr_adult]]

⥅ related node [[english_cpr_infants]]

⥅ related node [[english_diabetes]]

⥅ related node [[english_drsabcd]]

⥅ related node [[english_electric_shock]]

⥅ related node [[english_epileptic_seizure]]

⥅ related node [[english_fainting]]

⥅ related node [[english_febrile_convulsion]]

⥅ related node [[english_first_aid_kit]]

⥅ related node [[english_fracture_and_dislocation]]

⥅ related node [[english_frost_bite]]

⥅ related node [[english_handrub]]

⥅ related node [[english_handwashing]]

⥅ related node [[english_heart_attack]]

⥅ related node [[english_heat induced]]

⥅ related node [[english_home_quarantine_plan]]

⥅ related node [[english_hypothermia]]

⥅ related node [[english_nose_bleed]]

⥅ related node [[english_poisoning]]

⥅ related node [[english_recovery_position]]

⥅ related node [[english_severe_bleeding]]

⥅ related node [[english_shock]]

⥅ related node [[english_smoke_or_embers_in_eyes]]

⥅ related node [[english_snake_bite]]

⥅ related node [[english_spider_bites]]

⥅ related node [[english_spinal_and_neck_injury]]

⥅ related node [[english_sprain_and_strain]]

⥅ related node [[english_stroke]]

⥅ related node [[english_working_from_home]]

⥅ related node [[first aid main page]]

⥅ related node [[badass latin threat]]

⥅ related node [[hamradiocheatsheet]]

⥅ related node [[phoneticalphabet]]

⥅ related node [[radio frequency spectrum]]

⥅ related node [[command_cheat_sheet_cartoon]]

⥅ related node [[wget_cheat_sheet]]

⥅ related node [[alternatives to getting better ]]

⥅ related node [[afirm project s list of mental health contacts]]

⥅ related node [[mental health resources section]]

⥅ related node [[a mostly complete chart of neural networks]]

⥅ related node [[general dynamic vs static and compiled vs interpreted]]

⥅ related node [[general resources for all languages]]

⥅ related node [[javascript absolute basics]]

⥅ related node [[javascript comments]]

⥅ related node [[javascript data types]]

⥅ related node [[javascript emmet]]

⥅ related node [[javascript intro to udemy course]]

⥅ related node [[javascript main page]]

⥅ related node [[javascript variable mutation and type coercion]]

⥅ related node [[programming main page]]

⥅ related node [[python how to write test units]]

⥅ related node [[python main page]]

⥅ related node [[python making an importable python module]]

⥅ related node [[python proper python project preparation]]

⥅ related node [[cheatsheet]]

⥅ related node [[coil_rank]]

⥅ related node [[eithwdfuyaawjxr]]

⥅ related node [[filescheat]]

⥅ related node [[expressions and variables]]

⥅ related node [[introduction to python data types]]

⥅ related node [[python string operations]]

⥅ related node [[python week 1 main page]]

⥅ related node [[sharing a jupyter notebook to github]]

⥅ related node [[week1 string operations lab]]

⥅ related node [[week1 types expressions and variables lab]]

⥅ related node [[python dictionaries]]

⥅ related node [[python lists and tuples]]

⥅ related node [[python sets]]

⥅ related node [[python week 2 main page]]

⥅ related node [[week2 dictionaries lab]]

⥅ related node [[week2 lists lab]]

⥅ related node [[week2 sets lab]]

⥅ related node [[week2 tuples lab]]

⥅ related node [[python classes]]

⥅ related node [[python conditions and branching]]

⥅ related node [[python function scope global vs local]]

⥅ related node [[python functions]]

⥅ related node [[python loops for loops]]

⥅ related node [[python loops while loops]]

⥅ related node [[python week 3 main page]]

⥅ related node [[week3 classes and objects lab]]

⥅ related node [[week3 conditions and branching lab]]

⥅ related node [[week3 functions and scope lab]]

⥅ related node [[week3 python for and while loops lab]]

⥅ related node [[filtering and saving data with pandas]]

⥅ related node [[one dimensional numpy]]

⥅ related node [[python file handling reading]]

⥅ related node [[python file handling writing]]

⥅ related node [[python ibm api assignment lab]]

⥅ related node [[python week 4 main page]]

⥅ related node [[simple apis in python]]

⥅ related node [[two dimensional numpy]]

⥅ related node [[week4 numpy in one dimension lab]]

⥅ related node [[week4 numpy in two dimensions lab]]

⥅ related node [[week4 pandas data lab]]

⥅ related node [[week4 reading from files lab]]

⥅ related node [[week4 writing to files lab]]

⥅ related node [[ibm digital badge python for applied data science]]

⥅ related node [[python week 5 main page]]

⥅ related node [[week5 us economic dashboard in python lab]]

⥅ related node [[find all divs with attributes]]

⥅ related node [[find all headings with attributes]]

⥅ related node [[regex grimoire]]

⥅ related node [[the non greedy question mark]]

⥅ related node [[brackets]]

⥅ related node [[google chrome developer tools]]

⥅ related node [[vs code]]

⥅ related node [[code and calculations master page]]

⥅ related node [[friends and contacts list]]

⥅ related node [[international contacts master list]]

⥅ related node [[list of examinations and certifications]]

⥅ related node [[practice exercise list]]

⥅ related node [[radio equipment checklist]]

⥅ related node [[radio equipment manuals master list]]

⥅ related node [[radio equipment wishlist]]

⥅ related node [[radio projects master page]]

⥅ related node [[radio readings master list]]

⥅ related node [[signals and radio main page]]

⥅ related node [[affirmative defense]]

⥅ related node [[battery law]]

⥅ related node [[business interference]]

⥅ related node [[civil law]]

⥅ related node [[compensatory damages]]

⥅ related node [[contract law]]

⥅ related node [[copyright law]]

⥅ related node [[criminal law]]

⥅ related node [[defamation]]

⥅ related node [[erisa]]

⥅ related node [[fair use]]

⥅ related node [[government law]]

⥅ related node [[ip infringement]]

⥅ related node [[jury instructions]]

⥅ related node [[law box]]

⥅ related node [[law]]

⥅ related node [[liability insurance]]

⥅ related node [[property law]]

⥅ related node [[punitive damages]]

⥅ related node [[regulatory law]]

⥅ related node [[tax law]]

⥅ related node [[tort law]]

⥅ related node [[2021 12 17]]

⥅ related node [[alter sapukai radio]]

⥅ related node [[análisis del discurso político]]

⥅ related node [[arooj aftab]]

⥅ related node [[bibliografía aleixandre]]

⥅ related node [[caen octavillas desde el cielo]]

⥅ related node [[campos de níjar]]

⥅ related node [[classical dark academia]]

⥅ related node [[cosmopolitanism]]

⥅ related node [[david m bunis]]

⥅ related node [[ddddd]]

⥅ related node [[de la lira a la silva]]

⥅ related node [[decadence and aestheticism]]

⥅ related node [[decadent love]]

⥅ related node [[diana drake]]

⥅ related node [[diego armando maradona]]

⥅ related node [[dudas rápidas]]

⥅ related node [[dudas]]

⥅ related node [[edward w said]]

⥅ related node [[el insomnio de bolívar]]

⥅ related node [[el síndrome de falcón]]

⥅ related node [[emiliozzi irma]]

⥅ related node [[frantz fannon]]

⥅ related node [[gayatri spivak]]

⥅ related node [[gloria anzaldúa]]

⥅ related node [[hacia la recuperación de las memorias dispersas de vicente aleixandre]]

⥅ related node [[homi k bhabha]]

⥅ related node [[hélène cixous]]

⥅ related node [[indianismos e indigenismos en hispanoamérica]]

⥅ related node [[indicios raíces de un paradigma de inferencias indiciales]]

⥅ related node [[introducción el malestar del compromiso]]

⥅ related node [[introduction the graphic novel a special type of comics]]

⥅ related node [[juan goytisolo la lengua común]]

⥅ related node [[judeoespañol]]

⥅ related node [[judith butler]]

⥅ related node [[la autobiografía del 27]]

⥅ related node [[la ciudad ausente]]

⥅ related node [[la forma externa la fuerza coercitiva de la estrofa]]

⥅ related node [[la hora de los hornos]]

⥅ related node [[la literatura perseguida por la política]]

⥅ related node [[la novela española contemporánea]]

⥅ related node [[la novela latinoamericana frente al espejo]]

⥅ related node [[la teoría de la argumentación una perspectiva pragmadialéctica]]

⥅ related node [[language and superdiversity]]

⥅ related node [[lengua y superdiversidad]]

⥅ related node [[los que luchan y al fin comprenden]]

⥅ related node [[luce irigaray]]

⥅ related node [[marina franco]]

⥅ related node [[motivos tradiciones y géneros en la poesía de la edad dorada]]

⥅ related node [[multitudes del yo biografía e historia de las mujeres]]

⥅ related node [[nation state transnationalism and language]]

⥅ related node [[on the genealogy of morals excerpts]]

⥅ related node [[operación masacre]]

⥅ related node [[pinceladas sobre una poeta española ángela figuera aymerich]]

⥅ related node [[recording 20210507015306 webm]]

⥅ related node [[recursos poéticos]]

⥅ related node [[retórica y estructura]]

⥅ related node [[rhetoric of political speeches]]

⥅ related node [[rhetorical analysis]]

⥅ related node [[rodolfo walsh]]

⥅ related node [[rosa_latino_ilias]]

⥅ related node [[sartre y estados unidos]]

⥅ related node [[sartre s america review]]

⥅ related node [[semiotics the basics]]

⥅ related node [[sigmund freud]]

⥅ related node [[starke verben]]

⥅ related node [[stephen greenblatt]]

⥅ related node [[stuart hall]]

⥅ related node [[temas de la poesía del siglo de oro]]

⥅ related node [[template semana]]

⥅ related node [[the graphic novel an introduction]]

⥅ related node [[the name of the rose]]

⥅ related node [[the sexual psychology of decadence]]

⥅ related node [[the task of the translator]]

⥅ related node [[transformaciones estructurales de la esfera pública]]

⥅ related node [[un epistolario de vicente aleixandre]]

⥅ related node [[unsam edita]]

⥅ related node [[what is literature]]

⥅ related node [[what is mode]]

⥅ related node [[zeichen text und sinn theorie und praxis der multimodalen textanalyse]]

⥅ related node [[2022 02 08]]

⥅ related node [[2022 02 10]]

⥅ related node [[2022 03 08]]

⥅ related node [[agathodaemon]]

⥅ related node [[alcoholics anonymous was conceived in a drug induced hallucination]]

⥅ related node [[altsearch]]

⥅ related node [[benedictine agora]]

⥅ related node [[beryl]]

⥅ related node [[bio cement and bio concrete]]

⥅ related node [[bioregional knowledge]]

⥅ related node [[books olia lialina turing complete user]]

⥅ related node [[candlemas]]

⥅ related node [[cinni]]

⥅ related node [[clay shirky on situated software]]

⥅ related node [[data exports should have to work as data imports]]

⥅ related node [[david bentley hart on christian socialism]]

⥅ related node [[derrida on heidegger on aristotle]]

⥅ related node [[douglas fir]]

⥅ related node [[dunbars number]]

⥅ related node [[five year old advice]]

⥅ related node [[glitch tiddlywiki]]

⥅ related node [[golden dawn]]

⥅ related node [[human scale computing]]

⥅ related node [[indieweb agora]]

⥅ related node [[inflation]]

⥅ related node [[john beckett on animism]]

⥅ related node [[kate wagner on the housing crisis]]

⥅ related node [[knockoffs]]

⥅ related node [[konmari]]

⥅ related node [[lionel shriver on grammar]]

⥅ related node [[matrix art]]

⥅ related node [[maya blue]]

⥅ related node [[net neutrality]]

⥅ related node [[olga khazan on slack and remote work]]

⥅ related node [[one weird hack]]

⥅ related node [[pastila]]

⥅ related node [[populus viewer]]

⥅ related node [[quamash]]

⥅ related node [[quasiquote]]

⥅ related node [[reddit on official priestly roles in ancient rome]]

⥅ related node [[soviet immersion heaters]]

⥅ related node [[st hildegard of bingen]]

⥅ related node [[stripes in architecture]]

⥅ related node [[tiny home builders]]

⥅ related node [[user styles]]

⥅ related node [[user scripts hypothesis]]

⥅ related node [[wouter groeneveld on constraints and parchment]]

⥅ related node [[100_rabbits]]

⥅ related node [[2022 02 09_melanocarpa_in_mothra]]

⥅ related node [[2022 02 09_melanocarpa_in_visurf]]

⥅ related node [[2022 04 02_melanocarpa_reskin]]

⥅ related node [[after]]

⥅ related node [[before]]

⥅ related node [[2022 04 18_melanocarpa_on_old_samsung]]

⥅ related node [[2022 06 05_bw_mycorrhiza]]

⥅ related node [[2022 06 11_instead]]

⥅ related node [[2022 06 27_заводь]]

⥅ related node [[2022 06 29_urban_owl]]

⥅ related node [[2022 09 18_melanocarpa_in_ie_mode]]

⥅ related node [[a11y]]

⥅ related node [[accepting_patches]]

⥅ related node [[acme]]

⥅ related node [[agpl]]

⥅ related node [[analog_nowhere_a]]

⥅ related node [[analytical_seclusion]]

⥅ related node [[araneo]]

⥅ related node [[ares_corp ]]

⥅ related node [[ares_logo]]

⥅ related node [[ares_robotics]]

⥅ related node [[aronia_zine]]

⥅ related node [[art_naming]]

⥅ related node [[as_viagens_a]]

⥅ related node [[auto portrait_2022 05 21]]

⥅ related node [[babylon]]

⥅ related node [[beetlang]]

⥅ related node [[betula_archival]]

⥅ related node [[betula_bookmarklet]]

⥅ related node [[betula_federated_search]]

⥅ related node [[betula_in_agora]]

⥅ related node [[betula_mascot_2023 02 01]]

⥅ related node [[betulopticon]]

⥅ related node [[bill_seitz]]

⥅ related node [[bill_seitz_twin_pages]]

⥅ related node [[biologia]]

⥅ related node [[bionicle]]

⥅ related node [[blame]]

⥅ related node [[book_software]]

⥅ related node [[bouncepedia]]

⥅ related node [[caemlyn]]

⥅ related node [[canon_cat]]

⥅ related node [[carpincho_y_durazno]]

⥅ related node [[celeste_summit]]

⥅ related node [[chito_2022 08 17]]

⥅ related node [[coin_columns]]

⥅ related node [[conductor]]

⥅ related node [[cotton_candy]]

⥅ related node [[cyberrachel_echochamber]]

⥅ related node [[date_format]]

⥅ related node [[december_adventure_2023]]

⥅ related node [[devine_lu_linvega]]

⥅ related node [[digital_garden]]

⥅ related node [[dillo]]

⥅ related node [[dithering]]

⥅ related node [[dormeraro]]

⥅ related node [[dream_computer]]

⥅ related node [[dune_(1984)]]

⥅ related node [[dune_(2021)]]

⥅ related node [[ed]]

⥅ related node [[elegant_objects]]

⥅ related node [[email]]

⥅ related node [[email_archiving]]

⥅ related node [[emergence]]

⥅ related node [[emondsfield]]

⥅ related node [[2020 10_photo]]

⥅ related node [[experiment_no _31]]

⥅ related node [[feather_wiki]]

⥅ related node [[fedidev]]

⥅ related node [[finish_it_jam_2023]]

⥅ related node [[flux_garden]]

⥅ related node [[flying_islands]]

⥅ related node [[forum]]

⥅ related node [[franz_kafka]]

⥅ related node [[fresh]]

⥅ related node [[gitea_federation]]

⥅ related node [[gnome]]

⥅ related node [[gnome_way]]

⥅ related node [[go_custom_domains]]

⥅ related node [[gui]]

⥅ related node [[hackable_software]]

⥅ related node [[hakurei_reimu_2022 07 27]]

⥅ related node [[hardstyle]]

⥅ related node [[homepage]]

⥅ related node [[hostname]]

⥅ related node [[how_to_release]]

⥅ related node [[html_journal]]

⥅ related node [[hypercard]]

⥅ related node [[hypha_stages]]

⥅ related node [[idec]]

⥅ related node [[indie_web]]

⥅ related node [[inktober]]

⥅ related node [[inktober_2020]]

⥅ related node [[01_fish]]

⥅ related node [[02_wisp]]

⥅ related node [[03_bulky]]

⥅ related node [[04_radio]]

⥅ related node [[05_blade]]

⥅ related node [[06_rodent]]

⥅ related node [[07_fancy]]

⥅ related node [[08_teeth]]

⥅ related node [[09_throw]]

⥅ related node [[10_hope]]

⥅ related node [[11_disgusting]]

⥅ related node [[12_slippery]]

⥅ related node [[13_dune]]

⥅ related node [[14_armor]]

⥅ related node [[15_outpost]]

⥅ related node [[16_rocket]]

⥅ related node [[17_storm]]

⥅ related node [[18_trap]]

⥅ related node [[19_dizzy]]

⥅ related node [[20_coral]]

⥅ related node [[21_sleep]]

⥅ related node [[22_chef]]

⥅ related node [[23_rip]]

⥅ related node [[24_dig]]

⥅ related node [[25_buddy]]

⥅ related node [[26_hide]]

⥅ related node [[27_music]]

⥅ related node [[28_float]]

⥅ related node [[29_shoes]]

⥅ related node [[30_ominous]]

⥅ related node [[31_crawl]]

⥅ related node [[inktober_2021]]

⥅ related node [[inktober_2022]]

⥅ related node [[01_gargoyle]]

⥅ related node [[02_scurry]]

⥅ related node [[03_bat]]

⥅ related node [[04_scallop]]

⥅ related node [[05_flame]]

⥅ related node [[06_bouquet]]

⥅ related node [[07_trip]]

⥅ related node [[08_match]]

⥅ related node [[09_nest]]

⥅ related node [[10_crabby]]

⥅ related node [[11_eagle]]

⥅ related node [[12_forget]]

⥅ related node [[13_kind]]

⥅ related node [[14_empty]]

⥅ related node [[15_armadillo]]

⥅ related node [[16_fowl]]

⥅ related node [[17_salty]]

⥅ related node [[18_scrape]]

⥅ related node [[19_ponytail]]

⥅ related node [[20_bluff]]

⥅ related node [[21_bad_dog]]

⥅ related node [[22_heist]]

⥅ related node [[23_booger]]

⥅ related node [[24_fairy]]

⥅ related node [[25_tempting]]

⥅ related node [[26_ego]]

⥅ related node [[27_snack]]

⥅ related node [[28_camping]]

⥅ related node [[29_uh oh]]

⥅ related node [[30_gear]]

⥅ related node [[31_farm]]

⥅ related node [[inktober_2023]]

⥅ related node [[01_dream]]

⥅ related node [[02_spiders]]

⥅ related node [[03_path]]

⥅ related node [[04_dodge]]

⥅ related node [[05_map]]

⥅ related node [[06_golden]]

⥅ related node [[07_drip]]

⥅ related node [[08_toad]]

⥅ related node [[09_bounce]]

⥅ related node [[10_fortune]]

⥅ related node [[11_wander]]

⥅ related node [[12_spicey]]

⥅ related node [[13_rise]]

⥅ related node [[14_castle]]

⥅ related node [[15_dagger]]

⥅ related node [[16_angel]]

⥅ related node [[17_demon]]

⥅ related node [[18_saddle]]

⥅ related node [[19_plump]]

⥅ related node [[20_frost]]

⥅ related node [[21_chains]]

⥅ related node [[22_scratchy]]

⥅ related node [[23_celestial]]

⥅ related node [[24_shallow]]

⥅ related node [[25_dangerous]]

⥅ related node [[26_remove]]

⥅ related node [[27_beast]]

⥅ related node [[inktober_2024]]

⥅ related node [[instead]]

⥅ related node [[interwiki_for_agora]]

⥅ related node [[la_rue_a]]

⥅ related node [[la_rue_b]]

⥅ related node [[lamp_2022 08 04]]

⥅ related node [[lapin]]

⥅ related node [[lapin_15]]

⥅ related node [[lapin_28]]

⥅ related node [[lapin_29]]

⥅ related node [[lapin_30]]

⥅ related node [[lapin_46]]

⥅ related node [[lapin_47]]

⥅ related node [[lapin_58]]

⥅ related node [[lapin_68]]

⥅ related node [[lapin_69]]

⥅ related node [[lapin_70]]

⥅ related node [[lapin_71]]

⥅ related node [[lapin_72]]

⥅ related node [[lapin_73]]

⥅ related node [[lapin_74]]

⥅ related node [[lapin_75]]

⥅ related node [[lapin_77]]

⥅ related node [[lapin_78]]

⥅ related node [[lapin_79]]

⥅ related node [[lapin_81]]

⥅ related node [[lapin_82]]

⥅ related node [[lapin_83]]

⥅ related node [[lapin_84]]

⥅ related node [[lapin_85]]

⥅ related node [[lapin_86]]

⥅ related node [[lapin_87]]

⥅ related node [[le_poisson_qui_rit]]

⥅ related node [[photo]]

⥅ related node [[lego]]

⥅ related node [[leviathan]]

⥅ related node [[library_man]]

⥅ related node [[lions_internet_office]]

⥅ related node [[literate_programming]]

⥅ related node [[lost_in_the_pipes]]

⥅ related node [[lua]]

⥅ related node [[mac_os]]

⥅ related node [[majime_yamashita_2022 07 28]]

⥅ related node [[markup]]

⥅ related node [[marmor]]

⥅ related node [[marmor_03]]

⥅ related node [[marmor_05]]

⥅ related node [[marmor_08]]

⥅ related node [[marmor_09]]

⥅ related node [[marmor_10]]

⥅ related node [[marmor_11]]

⥅ related node [[marmor_12]]

⥅ related node [[marmor_13]]

⥅ related node [[marmor_14]]

⥅ related node [[marmor_15]]

⥅ related node [[marmor_16]]

⥅ related node [[marmor_18]]

⥅ related node [[marmor_19]]

⥅ related node [[marmor_23]]

⥅ related node [[marvel_cinematic_universe]]

⥅ related node [[me_and_wiki]]

⥅ related node [[mediawiki]]

⥅ related node [[mediawiki_markup]]

⥅ related node [[megastructure]]

⥅ related node [[megastructure_image_storage]]

⥅ related node [[melanocarpa_history]]

⥅ related node [[memento_mori]]

⥅ related node [[mensoguloj_2022 08 05]]

⥅ related node [[merveilles_logo]]

⥅ related node [[merveilles_migration]]

⥅ related node [[metamorphosis]]

⥅ related node [[mini_cubes]]

⥅ related node [[mistreated_activities]]

⥅ related node [[moby dick]]

⥅ related node [[my_toots_expire]]

⥅ related node [[mycoclipper_2 0]]

⥅ related node [[mycorrhiza_iceberg]]

⥅ related node [[narcissus_and_goldmund]]

⥅ related node [[nomad_balloon]]

⥅ related node [[now_page]]

⥅ related node [[on_bookmark_managers]]

⥅ related node [[patchouli]]

⥅ related node [[paysage_2022 06 01]]

⥅ related node [[pipepunk]]

⥅ related node [[pipepunk_gallery]]

⥅ related node [[playdate]]

⥅ related node [[portable_interwiki]]

⥅ related node [[posse]]

⥅ related node [[programming]]

⥅ related node [[punch_card]]

⥅ related node [[pyramidsfeld]]

⥅ related node [[quadrat]]

⥅ related node [[quadrat_01]]

⥅ related node [[quadrat_02]]

⥅ related node [[quadrat_03]]

⥅ related node [[quadrat_04]]

⥅ related node [[cut]]

⥅ related node [[quadrat_06]]

⥅ related node [[quadrat_08]]

⥅ related node [[quadrat_11]]

⥅ related node [[quadrat_12]]

⥅ related node [[quadrat_13]]

⥅ related node [[quadrat_14]]

⥅ related node [[quadrat_15]]

⥅ related node [[quadrat_16]]

⥅ related node [[quadrat_17]]

⥅ related node [[quadrat_18]]

⥅ related node [[quadrat_19]]

⥅ related node [[quadrat_21]]

⥅ related node [[quadrat_22]]

⥅ related node [[quadrat_23]]

⥅ related node [[quadrat_24]]

⥅ related node [[quadrat_26]]

⥅ related node [[quadrat_27]]

⥅ related node [[quadrat_28]]

⥅ related node [[quadrat_29]]

⥅ related node [[quadrat_30]]

⥅ related node [[quadrat_31]]

⥅ related node [[quadrat_32]]

⥅ related node [[quadrat_33]]

⥅ related node [[quadrat_34]]

⥅ related node [[quadrat_35]]

⥅ related node [[quadrat_36]]

⥅ related node [[quadrat_37]]

⥅ related node [[quadrat_39]]

⥅ related node [[quadrat_44]]

⥅ related node [[quadrat_45]]

⥅ related node [[quadrat_47]]

⥅ related node [[quadrat_48]]

⥅ related node [[quadrat_49]]

⥅ related node [[quadrat_50]]

⥅ related node [[quadrat_51]]

⥅ related node [[quadrat_53]]

⥅ related node [[quadrat_54]]

⥅ related node [[quadrat_55]]

⥅ related node [[quadrat_56]]

⥅ related node [[quadrat_57]]

⥅ related node [[quadrat_58]]

⥅ related node [[quadrat_59]]

⥅ related node [[quadrat_60]]

⥅ related node [[quadrat_61]]

⥅ related node [[quadrat_62]]

⥅ related node [[quadrat_64]]

⥅ related node [[quadrat_65]]

⥅ related node [[quadrat_66]]

⥅ related node [[quadrat_67]]

⥅ related node [[quadrat_68]]

⥅ related node [[quadrat_69]]

⥅ related node [[quadrat_72]]

⥅ related node [[quadrat_gallery]]

⥅ related node [[quarrel_by_pipes]]

⥅ related node [[quercus]]

⥅ related node [[questioning_wall]]

⥅ related node [[r_gui]]

⥅ related node [[rpn_calculator]]

⥅ related node [[school_of_fish]]

⥅ related node [[seclusion_tip]]

⥅ related node [[serenity_os]]

⥅ related node [[serious_gui]]

⥅ related node [[sins]]

⥅ related node [[smolnet]]

⥅ related node [[social_network]]

⥅ related node [[solinopolis]]

⥅ related node [[sourcehut]]

⥅ related node [[spartan]]

⥅ related node [[static_site]]

⥅ related node [[summer_playlist]]

⥅ related node [[summer_stream_2022]]

⥅ related node [[uxn_3 2_ttt]]

⥅ related node [[uxn_3_ttt]]

⥅ related node [[uxn_3_walker]]

⥅ related node [[sunskribo]]

⥅ related node [[sustainability]]

⥅ related node [[syndication]]

⥅ related node [[tarvalon]]

⥅ related node [[tech_meet]]

⥅ related node [[tech_meet_2022 03 06]]

⥅ related node [[tech_meet_2022 07 04]]

⥅ related node [[tech_meet_2022 07 22]]

⥅ related node [[tech_meet_2022 09 09]]

⥅ related node [[telegra ph]]

⥅ related node [[temperament tal]]

⥅ related node [[temple_os]]

⥅ related node [[the_algorithm]]

⥅ related node [[the_glass_bead_game]]

⥅ related node [[the_mathematician]]

⥅ related node [[the_ones_who_walk_away_from_omelas]]

⥅ related node [[the_sentient_pipes]]

⥅ related node [[thinkpad]]

⥅ related node [[tkmiz]]

⥅ related node [[toot_expirator]]

⥅ related node [[toot_expirator_source]]

⥅ related node [[toot_expirator_workflow]]

⥅ related node [[tour_bus]]

⥅ related node [[tour_bus_stop]]

⥅ related node [[transcopyright]]

⥅ related node [[tree_sheets]]

⥅ related node [[twitter_exodus]]

⥅ related node [[tx_series]]

⥅ related node [[header_links]]

⥅ related node [[uxn]]

⥅ related node [[uxn_2022 03 27]]

⥅ related node [[bad_apple]]

⥅ related node [[launcher]]

⥅ related node [[left]]

⥅ related node [[uxn_legoptics]]

⥅ related node [[uxnerie]]

⥅ related node [[uxnpkg]]

⥅ related node [[ventosín]]

⥅ related node [[virtual_reality]]

⥅ related node [[vk]]

⥅ related node [[web_browser]]

⥅ related node [[what_is_a_wiki]]

⥅ related node [[wiki_engine]]

⥅ related node [[wikilinks_everywhere]]

⥅ related node [[xo tal]]

⥅ related node [[during_game]]

⥅ related node [[tie]]

⥅ related node [[youtrack_snippet]]

⥅ related node [[аватарка_в_интернете]]

⥅ related node [[агидель]]

⥅ related node [[алгоритм_определения_номера_месяца]]

⥅ related node [[боковая_линия]]

⥅ related node [[бритвы]]

⥅ related node [[вики]]

⥅ related node [[выдра]]

⥅ related node [[дневник]]

⥅ related node [[завязки]]

⥅ related node [[зелёная_2022 08 07]]

⥅ related node [[иглобрюх]]

⥅ related node [[идёт_после_дождя]]

⥅ related node [[кабачки_2022 10 06]]

⥅ related node [[канистра]]

⥅ related node [[капибара]]

⥅ related node [[качели]]

⥅ related node [[квазимодо]]

⥅ related node [[киберрахиль]]

⥅ related node [[кола]]

⥅ related node [[критика_микоризы]]

⥅ related node [[крупно кашевое]]

⥅ related node [[лонгисквама]]

⥅ related node [[любимые_цветы]]

⥅ related node [[микориза]]

⥅ related node [[мыло]]

⥅ related node [[настольные_игры]]

⥅ related node [[наш_код]]

⥅ related node [[не_слушай_2022 08 05]]

⥅ related node [[новая_пунктуация]]

⥅ related node [[новогоднее_бдение]]

⥅ related node [[о_мобильных_приложениях]]

⥅ related node [[ода_электрочайникам]]

⥅ related node [[ортовремя]]

⥅ related node [[иллюстрация]]

⥅ related node [[ошибки_микоризы]]

⥅ related node [[переходник_на_эфирнет]]

⥅ related node [[песке_2021_апрель]]

⥅ related node [[плоды_с_лицами]]

⥅ related node [[поисковик]]

⥅ related node [[поток]]

⥅ related node [[публикация_картинок]]

⥅ related node [[рыба]]

⥅ related node [[самоходный_позвоночник]]

⥅ related node [[светофор_2022 08 06]]

⥅ related node [[сидит_по турецки]]

⥅ related node [[сода]]

⥅ related node [[список_желаний]]

⥅ related node [[сьедобная_история_человечества]]

⥅ related node [[тестирование_скриншотами]]

⥅ related node [[тетрапод]]

⥅ related node [[три_критерия_дурности_математики]]

⥅ related node [[тыква_2021 04 26]]

⥅ related node [[удалённое_из_мастодонта]]

⥅ related node [[упаковка_соусов]]

⥅ related node [[уютная_тумбочка]]

⥅ related node [[фрукты]]

⥅ related node [[цифровой_сад]]

⥅ related node [[bring back instagram]]

⥅ related node [[cactus comments]]

⥅ related node [[cross posting to git]]

⥅ related node [[design a logo]]

⥅ related node [[dev server]]

⥅ related node [[foozmeat]]

⥅ related node [[gitlab pages]]

⥅ related node [[instagram]]

⥅ related node [[moaparty]]

⥅ related node [[opencollective]]

⥅ related node [[options]]

⥅ related node [[privacy policy]]

⥅ related node [[support our dependencies]]

⥅ related node [[support pleroma]]

⥅ related node [[what is a moa]]

⥅ related node [[2018 07 18 no replies mentions twitter]]

⥅ related node [[2019 01 05 twitter not required]]

⥅ related node [[2020 09 07 instagram disabled]]

⥅ related node [[2021 03 10 fedstoa maintained]]

⥅ related node [[2021 03 14 welcome moa party]]

⥅ related node [[2021 03 17 twitter api key error]]

⥅ related node [[2021 03 22 dns error]]

⥅ related node [[2021 03 28 masto account move]]

⥅ related node [[2021 04 08 thank you maxime]]

⥅ related node [[2021 05 30 cactus comments]]

⥅ related node [[2023 02 05 twitter api fees shutdown]]

⥅ related node [[cactus500]]

⥅ related node [[maxime ko fi]]

⥅ related node [[moa options]]

⥅ related node [[crowdmark]]

⥅ related node [[crowdmark labeler]]

⥅ related node [[econ ipsum]]

⥅ related node [[hash viewer]]

⥅ related node [[jekyll citations]]

⥅ related node [[1 5c]]

⥅ related node [[1 problem]]

⥅ related node [[10 year phone]]

⥅ related node [[15 m movement]]

⥅ related node [[15 minute city]]

⥅ related node [[1888]]

⥅ related node [[19 broken laptops]]

⥅ related node [[1917]]

⥅ related node [[1922]]

⥅ related node [[1947]]

⥅ related node [[1948]]

⥅ related node [[1990]]

⥅ related node [[1991 eruption of mount pinatubo]]

⥅ related node [[1991]]

⥅ related node [[2000 watt society]]

⥅ related node [[2008 financial crisis]]

⥅ related node [[2011]]

⥅ related node [[2016]]

⥅ related node [[2020 03 09]]

⥅ related node [[2020 03 19_23 27 44_iscape]]

⥅ related node [[2020 03 21_11 17 23_screenshot]]

⥅ related node [[2020 03 21_22 11 58_serveimage]]

⥅ related node [[2020 03 21_22 13 19_serveimage]]

⥅ related node [[2020 03 27]]

⥅ related node [[2020 03 28]]

⥅ related node [[2020 03 29]]

⥅ related node [[2020 04 01]]

⥅ related node [[2020 04 02]]

⥅ related node [[2020 04 04]]

⥅ related node [[2020 04 24_21 59 13_20200424_195217 scaled]]

⥅ related node [[2020 04 30]]

⥅ related node [[2020 05 11]]

⥅ related node [[2020 05 12]]

⥅ related node [[2020 05 14]]

⥅ related node [[2020 05 25_10 35 37_die_zwitscher maschine_ 28twittering_machine 29]]

⥅ related node [[2020 05 31]]

⥅ related node [[2020 06 07_16 12 50_rhizome]]

⥅ related node [[2020 06 07_16 17 57_capitalist_realism_cover]]

⥅ related node [[2020 06 07_18 23 54_diamond dust shoes]]

⥅ related node [[2020 06 07_19 49 17_1*e9fsswodw1y5wwxjubtjaa]]

⥅ related node [[2020 06 15_20 26 25_9781784782924 eee743ba813f726f0ef78c27fdea782c]]

⥅ related node [[2020 06 15_21 17 48_tabula1]]

⥅ related node [[2020 06 22]]

⥅ related node [[2020 06 25]]

⥅ related node [[2020 06 26]]

⥅ related node [[2020 06 30]]

⥅ related node [[2020 07 01]]

⥅ related node [[2020 07 03]]

⥅ related node [[2020 07 04_09 07 20_screenshot]]

⥅ related node [[2020 07 04_09 12 21_screenshot]]

⥅ related node [[2020 07 11_18 23 34_screenshot]]

⥅ related node [[2020 07 11_22 50 24_screenshot]]

⥅ related node [[2020 07 12_20 52 23_screenshot]]

⥅ related node [[2020 07 18_22 02 10_artificialfictionbrain]]

⥅ related node [[2020 07 19_13 26 49_screenshot]]

⥅ related node [[2020 07 25_15 55 34_1539194616471]]

⥅ related node [[2020 07 28]]

⥅ related node [[2020 09]]

⥅ related node [[2020 10]]

⥅ related node [[2020 11]]

⥅ related node [[2020 12 05_08 15 39_screenshot]]

⥅ related node [[2021 04 03_10 47 49_ms0ahqu]]

⥅ related node [[2021 08 28_19 35 12_137071_1]]

⥅ related node [[2021 10 16_14 28 37_screenshot]]

⥅ related node [[2021 10 25_19 18 43_screenshot]]

⥅ related node [[2021 10 25_19 23 56_screenshot]]

⥅ related node [[2021 10 25_19 25 05_screenshot]]

⥅ related node [[2021 10 25_19 29 52_screenshot]]

⥅ related node [[2021 10 25_19 33 09_screenshot]]

⥅ related node [[2021 10 25_19 35 21_zfochua]]

⥅ related node [[2021 10 25_19 36 50_screenshot]]

⥅ related node [[2021]]

⥅ related node [[2022 02 05_14 36 11_screenshot]]

⥅ related node [[2022 02 18_21 57 51_screenshot]]

⥅ related node [[2022 03 05_21 02 06_screenshot]]

⥅ related node [[2022 03 26_18 49 49_screenshot]]

⥅ related node [[2022 07 18_21 22 05_screenshot]]

⥅ related node [[2022 07 18_21 24 33_screenshot]]

⥅ related node [[2022 07 18_21 27 32_screenshot]]

⥅ related node [[2022 07 18_21 32 05_screenshot]]

⥅ related node [[2022 07 18_21 36 53_screenshot]]

⥅ related node [[2022 pakistan floods]]

⥅ related node [[2022 week 14 summary]]

⥅ related node [[2022 week 15 summary]]

⥅ related node [[2022 week 16 summary]]

⥅ related node [[2022 week 17 summary]]

⥅ related node [[2022 westmorland and furness council election]]

⥅ related node [[2022]]

⥅ related node [[2023 10 25_21 42 54_screenshot]]

⥅ related node [[2023 11 04_18 33 52_screenshot]]

⥅ related node [[2023 french pension reform unrest]]

⥅ related node [[2024 03 04_21 02 30_screenshot]]

⥅ related node [[2040]]

⥅ related node [[2050]]

⥅ related node [[21st century revolutions]]

⥅ related node [[2c]]

⥅ related node [[3d printing]]

⥅ related node [[3ir and 4ir]]

⥅ related node [[3ir]]

⥅ related node [[404]]

⥅ related node [[42 tech for good]]

⥅ related node [[4ir]]

⥅ related node [[5g]]

⥅ related node [[5tracks week 44]]

⥅ related node [[5tracks week 45]]

⥅ related node [[5tracks week 46]]

⥅ related node [[5tracks]]

⥅ related node [[8 principles for managing a commons]]

⥅ related node [[84k]]

⥅ related node [[9 11]]

⥅ related node [[90 9 1 rule]]

⥅ related node [[a beginners guide to neoliberalism]]

⥅ related node [[a blast in manhattan]]

⥅ related node [[a brief history ethos of the digital garden]]

⥅ related node [[a chat with henry zhu on oss gift economies]]

⥅ related node [[a closed and common orbit]]

⥅ related node [[a common platform reimagining data and platforms]]

⥅ related node [[a commons is a politics of belonging]]

⥅ related node [[a creative multiplicity the philosophy of deleuze and guattari]]

⥅ related node [[a drift in the gardens]]

⥅ related node [[a forgotten revolutionary thomas spence on saving the commons]]

⥅ related node [[a game of war]]

⥅ related node [[a garden of gardens]]

⥅ related node [[a good zettelkasten is both horizontal and vertical]]

⥅ related node [[a green new deal that works for people and planet with max ajl]]

⥅ related node [[a hacker manifesto]]

⥅ related node [[a half built garden]]

⥅ related node [[a home for all six experiments in social housing]]

⥅ related node [[a long overdue moment the uk greens pushing for the nuclear option]]

⥅ related node [[a memory of empire]]

⥅ related node [[a modern anarchism part 1 anarchist analysis]]

⥅ related node [[a new grammar of organization]]

⥅ related node [[a paradise built in hell]]

⥅ related node [[a participatory culture requires a participatory infrastructure]]

⥅ related node [[a pattern language for political organisation]]

⥅ related node [[a peoples green new deal]]

⥅ related node [[a peoples guide to capitalism]]

⥅ related node [[a personal wiki is primarily for you]]

⥅ related node [[a platform designed for collaboration federated wiki]]

⥅ related node [[a political ecology of the repair manual]]

⥅ related node [[a psalm for the wild built]]

⥅ related node [[a re commonification of welfare systems]]

⥅ related node [[a short history of nearly everything]]

⥅ related node [[a simple plan to save the world w drew pendergrass troy vettese]]

⥅ related node [[a socialist agenda for digital technology]]

⥅ related node [[a solarpunk manifesto]]

⥅ related node [[a syrian democratic social economy in the making]]

⥅ related node [[a system for writing]]

⥅ related node [[a systems literacy manifesto]]

⥅ related node [[a text renaissance]]

⥅ related node [[a thousand plateaus]]

⥅ related node [[a traversal network of feminist servers]]

⥅ related node [[a wizard of earthsea]]

⥅ related node [[2020 04 11_22 54 00_1546721627881]]

⥅ related node [[2020 04 11_22 55 09_1546721647137]]

⥅ related node [[2020 04 11_22 55 35_1546721660648]]

⥅ related node [[2020 04 11_22 56 02_1546721686490]]

⥅ related node [[aaron bastani]]

⥅ related node [[aaron benanav on associational socialism and democratic planning]]

⥅ related node [[aaron benanav]]

⥅ related node [[aaron perzanowski]]

⥅ related node [[aaron swartz day]]

⥅ related node [[aasp]]

⥅ related node [[abdullah ocalan]]

⥅ related node [[abolition of intellectual property]]

⥅ related node [[abolition]]

⥅ related node [[abolitionist]]

⥅ related node [[aboriya jin]]

⥅ related node [[about 3 of the carbon humans produce comes from aviation]]

⥅ related node [[about this site]]

⥅ related node [[abs]]

⥅ related node [[absolute sovereignty]]

⥅ related node [[2022 11 17_23 21 54_1f059030d4b364bb]]

⥅ related node [[abundance think tank]]

⥅ related node [[abundance]]

⥅ related node [[ac and dc]]

⥅ related node [[accelerationism]]

⥅ related node [[access to repair information]]

⥅ related node [[access to spare parts]]

⥅ related node [[access]]

⥅ related node [[accessibility]]

⥅ related node [[accidental megastructure]]

⥅ related node [[accumulation]]

⥅ related node [[acer aspire s3]]

⥅ related node [[acfm 51 heroes]]

⥅ related node [[acfm microdose theories of consciousness]]

⥅ related node [[acfm trip 1 out of the box]]

⥅ related node [[acfm trip 4 love and hate]]

⥅ related node [[acfm trip 41 trust your gut]]

⥅ related node [[acfm trip 48 political commitment]]

⥅ related node [[acfm trip 5 consciousness raising]]

⥅ related node [[acfm]]

⥅ related node [[acid communism]]

⥅ related node [[acorn]]

⥅ related node [[acoustic commons]]

⥅ related node [[action network]]

⥅ related node [[active recall and passive repetition in the digital stream and garden]]

⥅ related node [[active repetition]]

⥅ related node [[actively thwart enclosure cooptation]]

⥅ related node [[activism]]

⥅ related node [[actor model]]

⥅ related node [[actor network theory]]

⥅ related node [[ada lovelace]]

⥅ related node [[adam curtis]]

⥅ related node [[adam day states of disorder ecosystems of governance]]

⥅ related node [[adam greenfield]]

⥅ related node [[adam smith]]

⥅ related node [[adaptation]]

⥅ related node [[adding a 404 page with htaccess]]

⥅ related node [[adding a list of nodes in my garden that are well connected]]

⥅ related node [[adding a new connections page to my garden]]

⥅ related node [[adding flashcards to your digital garden with org roam and anki]]

⥅ related node [[adding more storage space to yunohost nextcloud on hetzner]]

⥅ related node [[adding planted and last tended dates to pages in my digital garden]]

⥅ related node [[adding timestamps to org roam notes]]

⥅ related node [[adrienne maree brown]]

⥅ related node [[advertising platforms]]

⥅ related node [[affinity group]]

⥅ related node [[affinity groups]]

⥅ related node [[afro futurism]]

⥅ related node [[after geoengineering carbon removal and social transformation]]

⥅ related node [[after storming heaven]]

⥅ related node [[after the robots aaron benanav on work automation and utopia]]

⥅ related node [[against digital colonialism]]

⥅ related node [[agbogbloshie]]

⥅ related node [[agency]]

⥅ related node [[agent based modelling of predator prey dynamics]]

⥅ related node [[agent based modelling]]

⥅ related node [[agentic ai]]

⥅ related node [[agentic product development]]

⥅ related node [[agents]]

⥅ related node [[aggregate action]]

⥅ related node [[agi]]

⥅ related node [[agile and the long crisis of software]]

⥅ related node [[agriculture]]

⥅ related node [[agroecology and open source software]]

⥅ related node [[agroecology is an example of systems thinking]]

⥅ related node [[agroforestry]]

⥅ related node [[ai bubble]]

⥅ related node [[ai companies broke the labour market]]

⥅ related node [[ai is fueling a data center boom it must be stopped]]

⥅ related node [[ai is fuelling a data centre boom]]

⥅ related node [[ai resource use]]

⥅ related node [[ai vertigo]]

⥅ related node [[ai will not help to end capitalism]]

⥅ related node [[ai winter]]

⥅ related node [[ai]]

⥅ related node [[aiaiai headphones]]

⥅ related node [[aiaiai]]

⥅ related node [[aid in reverse]]

⥅ related node [[airline bailouts]]

⥅ related node [[ajamu nangwaya]]

⥅ related node [[alain badiou]]

⥅ related node [[alan kay]]

⥅ related node [[albedo]]

⥅ related node [[aleksander bogdanov]]

⥅ related node [[aleksandr solzhenitsyn]]

⥅ related node [[alex williams]]

⥅ related node [[alexander bogdanov]]

⥅ related node [[alexander cockburn]]

⥅ related node [[alexander lukashenko]]

⥅ related node [[alexnet]]

⥅ related node [[alfred schmidt]]

⥅ related node [[algae]]

⥅ related node [[algorithmic bias and racism]]

⥅ related node [[algorithmic bias]]

⥅ related node [[algorithmic decision making]]

⥅ related node [[algorithmic feed]]

⥅ related node [[algorithms of late capitalism]]

⥅ related node [[algorithms]]

⥅ related node [[alianza mesoamericana de pueblos y bosques]]

⥅ related node [[alibaba]]

⥅ related node [[alice bell]]

⥅ related node [[alienation]]

⥅ related node [[aligning the look of my garden and stream]]

⥅ related node [[all about upcycling android]]

⥅ related node [[all watched over by machines of loving grace adam curtis]]

⥅ related node [[all you need is links]]

⥅ related node [[allen ginsberg]]

⥅ related node [[allied media project]]

⥅ related node [[alnoor ladha]]

⥅ related node [[alphago]]

⥅ related node [[alt tab gesture on onyx boox devices]]

⥅ related node [[alter globalization]]

⥅ related node [[altered carbon]]

⥅ related node [[alternative currency]]

⥅ related node [[alternative economics]]

⥅ related node [[alternative media]]

⥅ related node [[alternative social media]]

⥅ related node [[alternatives to gdp]]

⥅ related node [[amazon doesnt care how you heat swimming pools ict and ecosocialism]]

⥅ related node [[amazon employees plan to walk off the job as tech worker tension rises]]

⥅ related node [[amazon exploits workers and is anti union]]

⥅ related node [[amazon is a chronic tax dodger]]

⥅ related node [[amazon ring]]

⥅ related node [[amazon sidewalk]]

⥅ related node [[amazon uk warehouse workers strike fund]]

⥅ related node [[amazon workers vote to strike at coventry depot in uk first]]

⥅ related node [[amazon]]

⥅ related node [[amazons union busting tactics]]

⥅ related node [[ambleside]]

⥅ related node [[american hegemony]]

⥅ related node [[americanism and fordism]]

⥅ related node [[amino acids]]

⥅ related node [[amstrad cpc 464]]

⥅ related node [[an eco socialist definition of abundance]]

⥅ related node [[an ecological technology an interview with james bridle]]

⥅ related node [[an ecosocialist strategy to win the future]]

⥅ related node [[an essay on liberation]]

⥅ related node [[an ethics of agency]]

⥅ related node [[an introduction to cybernetics]]

⥅ related node [[an iterative enquiry diagram for digital ecosocialism]]

⥅ related node [[an iterative inquiry diagram for digital ecosocialism]]

⥅ related node [[ana rodrigues]]

⥅ related node [[analytical engine]]

⥅ related node [[analytics]]

⥅ related node [[anarchism and right to repair]]

⥅ related node [[anarchism as a theory of organization]]

⥅ related node [[anarchism triumphant free software and the death of copyright]]

⥅ related node [[anarchist communist]]

⥅ related node [[anarchist vs marxist leninist thought on the organization of society]]

⥅ related node [[anarcho syndicalism]]

⥅ related node [[anatoly kitov]]

⥅ related node [[anchor institutions]]

⥅ related node [[ancillary justice]]

⥅ related node [[andor]]

⥅ related node [[andre gorz]]

⥅ related node [[andreas malm]]

⥅ related node [[andreas weber]]

⥅ related node [[andrew carnegie]]

⥅ related node [[andrew dana hudson]]

⥅ related node [[android apps i like]]

⥅ related node [[andy burnham]]

⥅ related node [[andy goldsworthy]]

⥅ related node [[angela davis]]

⥅ related node [[animal agriculture is the new crude oil]]

⥅ related node [[animal husbandry]]

⥅ related node [[animal protein]]

⥅ related node [[animals i like]]

⥅ related node [[animism]]

⥅ related node [[anna tsing]]

⥅ related node [[anne laure]]

⥅ related node [[another now]]

⥅ related node [[another world is necessary]]

⥅ related node [[another world is possible]]

⥅ related node [[ansible indieweb]]

⥅ related node [[ansible]]

⥅ related node [[ant colonies]]

⥅ related node [[ant man]]

⥅ related node [[antennapod]]

⥅ related node [[anthony fauci]]

⥅ related node [[anthropocene]]

⥅ related node [[anti austerity demonstrations in britain]]

⥅ related node [[anti austerity movement]]

⥅ related node [[anti authoritarian networking]]

⥅ related node [[anti authoritarianism]]

⥅ related node [[anti capitalism]]

⥅ related node [[anti capitalist praxis]]

⥅ related node [[anti capitalist]]

⥅ related node [[anti colonialism]]

⥅ related node [[anti economist]]

⥅ related node [[anti fascism]]

⥅ related node [[anti imperialism]]

⥅ related node [[anti oedipus]]

⥅ related node [[anti racism]]

⥅ related node [[anti racist systems theory]]

⥅ related node [[anti racist]]

⥅ related node [[anti trust and big tech]]

⥅ related node [[anti trust]]

⥅ related node [[anti union]]

⥅ related node [[antilibrary of articles]]

⥅ related node [[antilibrary]]

⥅ related node [[antistatic gardens]]

⥅ related node [[antonio gramsci]]

⥅ related node [[anxiety]]

⥅ related node [[any human power can be resisted and changed by human beings]]

⥅ related node [[anysoftkeyboard]]

⥅ related node [[anytype]]

⥅ related node [[aperture]]

⥅ related node [[appearing]]

⥅ related node [[apple 2022 environmental progress report]]

⥅ related node [[apple and right to repair]]

⥅ related node [[apple authorized service provider]]

⥅ related node [[apple expands the use of recycled materials across its products]]

⥅ related node [[apple macbook a1181]]

⥅ related node [[apple promised us a repair program where the hell is it]]

⥅ related node [[apple self service repair]]

⥅ related node [[apple]]

⥅ related node [[apples self repair vision is here and its got a catch]]

⥅ related node [[applied ecology]]

⥅ related node [[apply symbols value as variable is void symbolp]]

⥅ related node [[appropedia]]

⥅ related node [[appropriate digital]]

⥅ related node [[appropriate measures]]

⥅ related node [[appropriate technology]]

⥅ related node [[ar6 synthesis report]]

⥅ related node [[arab spring]]

⥅ related node [[arab winter]]

⥅ related node [[aral sea]]

⥅ related node [[aramis or the love of technology]]

⥅ related node [[architectural rights]]

⥅ related node [[architecture is politics]]

⥅ related node [[architecture of participation]]

⥅ related node [[archive of our own]]

⥅ related node [[archiving my tweets in my garden with orger]]

⥅ related node [[arctic ice cap]]

⥅ related node [[arctic permafrost]]

⥅ related node [[are na]]

⥅ related node [[argentina]]

⥅ related node [[armageddon]]

⥅ related node [[art i like]]

⥅ related node [[arthur brock]]

⥅ related node [[article]]

⥅ related node [[artificial cheapness of new products]]

⥅ related node [[artificial intelligence]]

⥅ related node [[artificial life]]

⥅ related node [[artificial scarcity]]

⥅ related node [[arts and crafts movement]]

⥅ related node [[as we may think]]

⥅ related node [[asad rehman]]

⥅ related node [[asapili]]

⥅ related node [[ask again later]]

⥅ related node [[aspiration manifesto]]

⥅ related node [[aspiration tech]]

⥅ related node [[assemblage thinking]]

⥅ related node [[assemblyism]]

⥅ related node [[asset manager]]

⥅ related node [[association algorithms]]

⥅ related node [[associational socialism]]

⥅ related node [[astra taylor]]

⥅ related node [[astrobiology]]

⥅ related node [[asymmetrical bandwidth]]

⥅ related node [[asynchronous collective distributed care]]

⥅ related node [[at least 130000 households in england made homeless in pandemic]]

⥅ related node [[atelier luma]]

⥅ related node [[atmosphere]]

⥅ related node [[attempting to ban protest is the mark of a repressive state]]

⥅ related node [[attempting to limit markets to just non essential sectors is risky]]

⥅ related node [[attention economy]]

⥅ related node [[audiobooks]]

⥅ related node [[augmented reality]]

⥅ related node [[aurora rising]]

⥅ related node [[austerity]]

⥅ related node [[austrian repair bonus voucher scheme in national geographic kids]]

⥅ related node [[austrian school]]

⥅ related node [[autechre]]

⥅ related node [[authoritarian and democratic technics]]

⥅ related node [[authoritarianism]]

⥅ related node [[authority in networks]]

⥅ related node [[autism]]

⥅ related node [[automatic commonplace to agora]]

⥅ related node [[automatic photo syncing from android to nextcloud]]

⥅ related node [[autonomism]]

⥅ related node [[autonomous design group]]

⥅ related node [[autonomous zone]]

⥅ related node [[autonomous]]

⥅ related node [[autonomy]]

⥅ related node [[autopoesis]]

⥅ related node [[autopoiesis]]

⥅ related node [[avengers age of ultron]]

⥅ related node [[avengers civil war]]

⥅ related node [[aviation]]

⥅ related node [[awkward scrobbling]]

⥅ related node [[aziz choudry]]

⥅ related node [[b corp]]

⥅ related node [[b4rn]]

⥅ related node [[back to nature tackling the biodiversity and climate crises]]

⥅ related node [[backing up my doom emacs config on termux]]

⥅ related node [[backmarket]]

⥅ related node [[backwards compatibility]]

⥅ related node [[bacteria]]

⥅ related node [[bad apple]]

⥅ related node [[baidu]]

⥅ related node [[bandcamp]]

⥅ related node [[bangla pesa]]

⥅ related node [[bangladesh]]

⥅ related node [[bank of england]]

⥅ related node [[barbican library]]

⥅ related node [[barcelona en comu]]

⥅ related node [[barclays]]

⥅ related node [[barnsley]]

⥅ related node [[barriers to repair]]

⥅ related node [[barrow]]

⥅ related node [[baruch spinoza]]

⥅ related node [[base building]]

⥅ related node [[base]]

⥅ related node [[basel convention]]

⥅ related node [[bashar al assad]]

⥅ related node [[bashar al assads decade of destruction in syria]]

⥅ related node [[basic income guarantee]]

⥅ related node [[bastien guerry]]

⥅ related node [[bathtub stockflow]]

⥅ related node [[batteries]]

⥅ related node [[battery energy storage systems]]

⥅ related node [[batterygate]]

⥅ related node [[battle of orgreave]]

⥅ related node [[battle of seattle]]

⥅ related node [[bayesian analysis]]

⥅ related node [[be right back]]

⥅ related node [[beancount]]

⥅ related node [[beating the bounds]]

⥅ related node [[beccs]]

⥅ related node [[becky chambers]]

⥅ related node [[becoming organizers]]

⥅ related node [[beg wolfhagen]]

⥅ related node [[behaviour change or system change]]

⥅ related node [[behaviour driven development]]

⥅ related node [[being having appearing]]

⥅ related node [[being working class in the climate movement]]

⥅ related node [[belarus]]

⥅ related node [[ben tarnoff wants to socialize the internet]]

⥅ related node [[ben tarnoff]]

⥅ related node [[benefits need to increase]]

⥅ related node [[benefits]]

⥅ related node [[benjamin bratton]]

⥅ related node [[berlin]]

⥅ related node [[bertie russell]]

⥅ related node [[best sustainable and repairable phones in 2020]]

⥅ related node [[better call saul]]

⥅ related node [[beware of the collectors fallacy]]

⥅ related node [[beyond bookchin]]

⥅ related node [[beyond the horizontal and the vertical]]

⥅ related node [[beyond the shouting match what is a blockchain really]]

⥅ related node [[beyond waste essential skills for a greener tomorrow]]

⥅ related node [[bezos earth fund]]

⥅ related node [[biased data sets]]

⥅ related node [[big data]]

⥅ related node [[big ole lists of note taking apps]]

⥅ related node [[big state]]

⥅ related node [[big tech exploits the victims of economic collapse]]

⥅ related node [[big tech is a huge part of capitalism]]

⥅ related node [[big tech is complicit in climate breakdown]]

⥅ related node [[big tech]]

⥅ related node [[bill gates]]

⥅ related node [[biochemistry]]

⥅ related node [[biocommunism]]

⥅ related node [[biodiversity loss]]

⥅ related node [[biodiversity]]

⥅ related node [[biogas]]

⥅ related node [[biologically inspired computing]]

⥅ related node [[biology of love]]

⥅ related node [[biometric profiling]]

⥅ related node [[biomimicry]]

⥅ related node [[biosphere 2]]

⥅ related node [[biosphere]]

⥅ related node [[bird flocks]]

⥅ related node [[bird of prey]]

⥅ related node [[birds of prey]]

⥅ related node [[birkrigg common]]

⥅ related node [[birth of the commune]]

⥅ related node [[bit tyrants]]

⥅ related node [[bitcoin]]

⥅ related node [[bittorrent]]

⥅ related node [[black box episode 5 the white mask]]

⥅ related node [[black box episode 6 shut it down]]

⥅ related node [[black box episode four bing and i]]

⥅ related node [[black box episode one the connectionists]]

⥅ related node [[black box episode three repocalypse now]]

⥅ related node [[black box prologue the collision]]

⥅ related node [[black box the hunt for clothoff the deepfake porn app]]

⥅ related node [[black box]]

⥅ related node [[black combe]]

⥅ related node [[black lives matter]]

⥅ related node [[black mirror]]

⥅ related node [[black panther party]]

⥅ related node [[black panther]]

⥅ related node [[black panthers vanguard of the revolution]]

⥅ related node [[blackrock]]

⥅ related node [[blade runner 2049]]

⥅ related node [[blade runner]]

⥅ related node [[blaenau ffestiniog]]

⥅ related node [[blavor pn w05]]

⥅ related node [[bliki tooling]]

⥅ related node [[bliki]]

⥅ related node [[block level transclusion]]

⥅ related node [[block protocol]]

⥅ related node [[blockades]]

⥅ related node [[blockchain for the political left]]

⥅ related node [[blog tooling]]

⥅ related node [[blogchain]]

⥅ related node [[blogchains and hyperconversations]]

⥅ related node [[blogging without a publish button]]

⥅ related node [[blogging]]

⥅ related node [[blood in the machine]]

⥅ related node [[blowback]]

⥅ related node [[blurting]]

⥅ related node [[blurts 2024 12 07]]

⥅ related node [[socialism blurt 2024 11 10]]

⥅ related node [[system blurt 2024 11 12]]

⥅ related node [[bob doto]]

⥅ related node [[bobby seale]]

⥅ related node [[bolivia]]

⥅ related node [[bolobolo]]

⥅ related node [[bolsheviks]]

⥅ related node [[bookmarked]]

⥅ related node [[bookmooch]]

⥅ related node [[books ive finished but have no claims]]

⥅ related node [[books to read soon]]

⥅ related node [[boom and bust cycle]]

⥅ related node [[boox firmware v3 5]]

⥅ related node [[boox handwriting recognition missing whole words out]]

⥅ related node [[boox note air plus 2]]

⥅ related node [[boox]]

⥅ related node [[boris johnson is a liar]]

⥅ related node [[boris johnson]]

⥅ related node [[bourgeois revolution]]

⥅ related node [[bourgeoisie]]

⥅ related node [[bp]]

⥅ related node [[bram buscher]]

⥅ related node [[branch]]

⥅ related node [[brazil film]]

⥅ related node [[bread and roses]]

⥅ related node [[breaking bad]]

⥅ related node [[breaking things at work]]

⥅ related node [[breht oshea]]

⥅ related node [[bretton woods]]

⥅ related node [[brexit]]

⥅ related node [[brid gy]]

⥅ related node [[bridge all the things]]

⥅ related node [[bristol approach]]

⥅ related node [[bristol energy cooperative]]

⥅ related node [[britain has soaring energy bills]]

⥅ related node [[britain is better off without bristols monument to colston]]

⥅ related node [[britain]]

⥅ related node [[britains computing industry]]

⥅ related node [[britains history contains astonishing levels of greed and cruelty]]

⥅ related node [[britains welfare system]]

⥅ related node [[british digital cooperative]]

⥅ related node [[british exceptionalism]]

⥅ related node [[british maoism]]

⥅ related node [[british post office scandal]]

⥅ related node [[brocken spectre]]

⥅ related node [[broken laptop apple powerbook g4]]

⥅ related node [[bronze age]]

⥅ related node [[brooklyn nine nine]]

⥅ related node [[brother dcp j4110dw]]

⥅ related node [[bruno latour]]

⥅ related node [[brussels effect]]

⥅ related node [[buddhist economics]]

⥅ related node [[buen vivir]]

⥅ related node [[build the new web in the shell of the old]]

⥅ related node [[build the new world in the shell of the old]]

⥅ related node [[building a second brain an overview]]

⥅ related node [[building a second brain]]

⥅ related node [[building a second subconscious]]

⥅ related node [[building alternative social media]]

⥅ related node [[building an open infrastructure for civic participation]]

⥅ related node [[building human economies using technology]]

⥅ related node [[building my own indieweb system]]

⥅ related node [[building orgzly]]

⥅ related node [[bullshit jobs]]

⥅ related node [[bundling]]

⥅ related node [[bunny fonts]]

⥅ related node [[burkina faso]]

⥅ related node [[butterflies]]

⥅ related node [[butternut bhuna]]

⥅ related node [[buurtzorg]]

⥅ related node [[buy nothing new month]]

⥅ related node [[buy nothing]]

⥅ related node [[buzzard from above]]

⥅ related node [[buzzard]]

⥅ related node [[buzzards]]

⥅ related node [[c40 cities]]

⥅ related node [[c4ss]]

⥅ related node [[cacophony of voices]]

⥅ related node [[calculating effort estimates and scheduled times in org mode]]

⥅ related node [[calculus of grit]]

⥅ related node [[calfw blocks]]

⥅ related node [[calfw]]

⥅ related node [[caliban and the witch]]

⥅ related node [[calibre web]]

⥅ related node [[california lawmakers unanimously pass right to repair legislation]]

⥅ related node [[california]]

⥅ related node [[californian dreams tech utopia or dystopia]]

⥅ related node [[can the real web 3 0 please stand up]]

⥅ related node [[can the us avoid another trump]]

⥅ related node [[can urban mining help to save the planet]]

⥅ related node [[canadian politics]]

⥅ related node [[cap and trade]]

⥅ related node [[capacity]]

⥅ related node [[capital is dead]]

⥅ related node [[capital markets must be socialized]]

⥅ related node [[capital markets]]

⥅ related node [[capital strike]]

⥅ related node [[capital]]

⥅ related node [[capitalism and migration]]

⥅ related node [[capitalism creates and shapes desires]]

⥅ related node [[capitalism demands constant technological change]]

⥅ related node [[capitalism is a complex adaptive system]]

⥅ related node [[capitalism is historically contingent]]

⥅ related node [[capitalism is the cause of the climate crisis]]

⥅ related node [[capitalism is the root cause of social inequity]]

⥅ related node [[capitalism is the root cause of the overshoot of planetary boundaries]]

⥅ related node [[capitalism must end]]

⥅ related node [[capitalism must take more from labour and nature than it gives back]]

⥅ related node [[capitalism produces high degrees of inequality]]

⥅ related node [[capitalism requires insecurity]]

⥅ related node [[capitalism tends towards the commodification of everything]]

⥅ related node [[capitalism will end]]

⥅ related node [[capitalisms power seems inescapable but so did the divine right of kings]]

⥅ related node [[capitalist catastrophism]]

⥅ related node [[capitalist class]]

⥅ related node [[capitalist economy]]

⥅ related node [[capitalist manufacturing manufacturing communism part 1 ft nick chavez]]

⥅ related node [[capitalist markets]]

⥅ related node [[capitalist realism]]

⥅ related node [[capitalist]]

⥅ related node [[capitalists need labour labour doesnt need capitalists]]

⥅ related node [[capitalocene]]

⥅ related node [[captain america civil war]]

⥅ related node [[captain america the winter soldier]]

⥅ related node [[captain fantastic]]

⥅ related node [[captains log]]

⥅ related node [[captp]]

⥅ related node [[capture ideas you disagree with]]

⥅ related node [[capture organize synthesize]]

⥅ related node [[carbon capture and sequestration]]

⥅ related node [[carbon coin]]

⥅ related node [[carbon dioxide emissions]]

⥅ related node [[carbon farming]]

⥅ related node [[carbon footprint]]

⥅ related node [[carbon inequality]]

⥅ related node [[carbon labelling]]

⥅ related node [[carbon offset markets]]

⥅ related node [[carbon pollution]]

⥅ related node [[carbon pricing]]

⥅ related node [[carbon removal]]

⥅ related node [[carbon sink]]

⥅ related node [[carbon]]

⥅ related node [[card stuffing]]

⥅ related node [[care principles for indigenous data governance]]

⥅ related node [[care work is infrastructure]]

⥅ related node [[care work]]

⥅ related node [[care]]

⥅ related node [[caribbean workers movement]]

⥅ related node [[carne ross]]

⥅ related node [[caroline shenaz hossein on black banker ladies and the social economy]]

⥅ related node [[caroline shenaz hossein]]

⥅ related node [[cars]]

⥅ related node [[cartografias da internet]]

⥅ related node [[cartographist]]

⥅ related node [[cat mate c500 automatic pet feeder]]

⥅ related node [[catalyst group]]

⥅ related node [[catalysts for revolution]]

⥅ related node [[catalysts for the french revolution]]

⥅ related node [[catch 22]]

⥅ related node [[cauliflower macaroni cheese]]

⥅ related node [[causal loop diagram]]

⥅ related node [[celebrate peoples history the poster book of resistance and revolution]]

⥅ related node [[cellular automata]]

⥅ related node [[centaur chess]]

⥅ related node [[center for a stateless society]]

⥅ related node [[center for humane technology]]

⥅ related node [[central planning]]

⥅ related node [[centralisation]]

⥅ related node [[centralised applications are authoritarian]]

⥅ related node [[century of the self]]

⥅ related node [[cerfi]]

⥅ related node [[challenging capitalism envisioning a socialist workplace]]

⥅ related node [[changes to councils in cumbria]]

⥅ related node [[changing the filename that org roam gives new notes]]

⥅ related node [[chaos on railways truss sunak take aim at solar power]]

⥅ related node [[chaos theory]]

⥅ related node [[charles baudelaire]]

⥅ related node [[charter of the forest]]

⥅ related node [[chartism]]

⥅ related node [[chatgpt will command more than 30000 nvidia gpus report]]

⥅ related node [[chattanooga gig]]

⥅ related node [[chauvinism]]

⥅ related node [[che guevara]]

⥅ related node [[cheap data]]

⥅ related node [[cheap labour]]

⥅ related node [[cheap nature]]

⥅ related node [[chechnya]]

⥅ related node [[checking for tls 1 2 support on a server]]

⥅ related node [[cheeseless pasta bake]]

⥅ related node [[cheikh anta diop]]

⥅ related node [[chemacs2]]

⥅ related node [[chemical pollution has passed safe limit for humanity]]

⥅ related node [[chemical pollution]]

⥅ related node [[chicago boys]]

⥅ related node [[child poverty]]

⥅ related node [[childcare]]

⥅ related node [[children of men]]

⥅ related node [[chile]]

⥅ related node [[chilean road to socialism]]

⥅ related node [[chilean student protests]]

⥅ related node [[chiles president aims to nationalize worlds largest lithium supply]]

⥅ related node [[china mieville]]

⥅ related node [[china pt 1 a socialist introduction w jason hickel]]

⥅ related node [[china]]

⥅ related node [[chip production]]

⥅ related node [[cholera]]

⥅ related node [[choose commons friendly financing]]

⥅ related node [[choral explanations and oer a summary of thinking to date]]

⥅ related node [[choral explanations]]

⥅ related node [[chorus of voices]]

⥅ related node [[chris martin]]

⥅ related node [[chris webber]]

⥅ related node [[christian fuchs]]

⥅ related node [[christmas 10k run 2025]]

⥅ related node [[christmas 10k run playlist]]

⥅ related node [[christmas]]

⥅ related node [[cia]]

⥅ related node [[circular economy action plan]]

⥅ related node [[circular economy]]

⥅ related node [[circular electronics initiative]]

⥅ related node [[citizen engagement]]

⥅ related node [[citizen participation platform]]

⥅ related node [[citizen participation]]

⥅ related node [[citizen science]]

⥅ related node [[citizen shift]]

⥅ related node [[citizens assembly]]

⥅ related node [[citymapper]]

⥅ related node [[civic action]]

⥅ related node [[civic muscle]]

⥅ related node [[civic platforms]]

⥅ related node [[civics]]

⥅ related node [[civil disobedience]]

⥅ related node [[civil liberties]]

⥅ related node [[civil rights movement]]

⥅ related node [[civilisation]]

⥅ related node [[claim]]

⥅ related node [[class abolition]]

⥅ related node [[class agency]]

⥅ related node [[class analysis]]

⥅ related node [[class composition]]

⥅ related node [[class conflict]]

⥅ related node [[class consciousness]]

⥅ related node [[class politics in a warming world with keir milburn]]

⥅ related node [[class politics]]

⥅ related node [[class privilege]]

⥅ related node [[class struggle]]

⥅ related node [[class war]]

⥅ related node [[class warfare in the information age]]

⥅ related node [[classification algorithms]]

⥅ related node [[claudia jones]]

⥅ related node [[clearing up drive space used by snap]]

⥅ related node [[cleverly pathetic on cost of living martin lewis sounds the alarm again]]

⥅ related node [[client server model]]

⥅ related node [[climate action plan explorer]]

⥅ related node [[climate action plan for councils]]

⥅ related node [[climate action plan]]

⥅ related node [[climate action tech]]

⥅ related node [[climate action]]

⥅ related node [[climate activism]]

⥅ related node [[climate anxiety]]

⥅ related node [[climate apartheid]]

⥅ related node [[climate apathy]]

⥅ related node [[climate assembly uk]]

⥅ related node [[climate behemoth]]

⥅ related node [[climate breakdown]]

⥅ related node [[climate capital and the state an interview with geoff mann]]

⥅ related node [[climate capitalism]]

⥅ related node [[climate change as class war building socialism on a warming planet]]

⥅ related node [[climate change as class war with matthew t huber]]

⥅ related node [[climate change committee]]

⥅ related node [[climate crisis]]

⥅ related node [[climate denial]]

⥅ related node [[climate emergency uk]]

⥅ related node [[climate fatalism]]

⥅ related node [[climate fiction]]

⥅ related node [[climate justice charter]]

⥅ related node [[climate justice is social justice]]

⥅ related node [[climate justice]]

⥅ related node [[climate leninism and revolutionary transition]]

⥅ related node [[climate leninism]]

⥅ related node [[climate leviathan with geoff mann]]

⥅ related node [[climate leviathan with joel wainwright and geoff mann]]

⥅ related node [[climate leviathan]]

⥅ related node [[climate mao]]

⥅ related node [[climate modelling]]

⥅ related node [[climate revolution how do we transition from catastrophe]]

⥅ related node [[climate sadism]]

⥅ related node [[climate science]]

⥅ related node [[climate solutions for cumbrian landscapes]]

⥅ related node [[climate strike]]

⥅ related node [[climate system]]

⥅ related node [[climate systems breakdown]]

⥅ related node [[climate vanguard]]

⥅ related node [[climate x]]

⥅ related node [[clinically extremenly vulnerable]]

⥅ related node [[clippings]]

⥅ related node [[clojure for the brave and true]]

⥅ related node [[cloud apps are problematic]]

⥅ related node [[cloud atlas]]

⥅ related node [[cloud capital]]

⥅ related node [[cloud commons]]

⥅ related node [[cloud computing]]

⥅ related node [[cloud inversion]]

⥅ related node [[cloud platforms]]

⥅ related node [[cloud rebellion]]

⥅ related node [[cloud software has benefits]]

⥅ related node [[cloudflare and stitcher]]

⥅ related node [[cloudflare]]

⥅ related node [[cloudron vs yunohost]]

⥅ related node [[cloudron]]

⥅ related node [[cloudspotting]]

⥅ related node [[clougha pike]]

⥅ related node [[club of rome]]

⥅ related node [[co op cloud]]

⥅ related node [[co opoly]]

⥅ related node [[co remembering]]

⥅ related node [[coal]]

⥅ related node [[cobudget]]

⥅ related node [[code as data]]

⥅ related node [[code commons]]

⥅ related node [[code kata]]

⥅ related node [[code red for humanity the ipcc report 2021]]

⥅ related node [[code review]]

⥅ related node [[codeberg]]

⥅ related node [[coffeedrinker stockflow]]

⥅ related node [[cognition]]

⥅ related node [[cognitive capitalism]]

⥅ related node [[collabora online]]

⥅ related node [[collaborative financing]]

⥅ related node [[collaborative legislation]]

⥅ related node [[collaborative memory palaces]]

⥅ related node [[collapse]]

⥅ related node [[collecting the dots]]

⥅ related node [[collective action]]

⥅ related node [[collective autonomy]]

⥅ related node [[collective farming]]

⥅ related node [[collective knowledge management]]

⥅ related node [[collective memory]]

⥅ related node [[collective self determination]]

⥅ related node [[collectivisation]]

⥅ related node [[collectivize or redistribute]]

⥅ related node [[collectivize]]

⥅ related node [[collector to creator]]

⥅ related node [[colombia]]

⥅ related node [[colonialism]]

⥅ related node [[colston four]]

⥅ related node [[colston]]

⥅ related node [[combination laws]]

⥅ related node [[comcom]]

⥅ related node [[commanding heights of the economy]]

⥅ related node [[commodification of information]]

⥅ related node [[commodification of nature]]

⥅ related node [[commodification]]

⥅ related node [[commodity fetishism disconnects us from where objects come from]]

⥅ related node [[commodity fetishism]]

⥅ related node [[commodity]]

⥅ related node [[common carriage]]

⥅ related node [[common darter]]

⥅ related node [[common on revolution in the 21st century]]

⥅ related node [[common wealth]]

⥅ related node [[commoner vs citizen]]

⥅ related node [[commoner]]

⥅ related node [[commoning in bolivia]]

⥅ related node [[commoning is a good way to solve coordination problems]]

⥅ related node [[commoning is based on a very different ontology from capitalism]]

⥅ related node [[commoning represents a profound challenge to capitalism]]

⥅ related node [[commoning]]

⥅ related node [[commonism]]

⥅ related node [[commonplace books]]

⥅ related node [[commons based internet]]

⥅ related node [[commons based peer production on the blockchain]]

⥅ related node [[commons based peer production]]

⥅ related node [[commons engine]]

⥅ related node [[commons hour 2]]

⥅ related node [[commons hour number 2]]

⥅ related node [[commons hour]]

⥅ related node [[commons network]]

⥅ related node [[commons p2p wiki requirements]]

⥅ related node [[commons public partnerships]]

⥅ related node [[commonsplace book]]

⥅ related node [[commonsverse]]

⥅ related node [[commown]]

⥅ related node [[communal living]]

⥅ related node [[communal luxury novarafm]]

⥅ related node [[communal luxury]]

⥅ related node [[communalism pamphlet]]

⥅ related node [[communalism]]

⥅ related node [[commune of communes]]

⥅ related node [[commune]]

⥅ related node [[communication capitalism critique]]

⥅ related node [[communication commons]]

⥅ related node [[communicative capitalism and class struggle]]

⥅ related node [[communicative capitalism]]

⥅ related node [[communicative socialism digital socialism]]

⥅ related node [[communism anarchism socialism]]

⥅ related node [[communism requires the abolition of money and the market system]]

⥅ related node [[communist manifesto]]

⥅ related node [[communist]]

⥅ related node [[communities of praxis]]

⥅ related node [[community benefit society]]

⥅ related node [[community broadband cooperative]]

⥅ related node [[community broadband]]

⥅ related node [[community controlled microfinance]]

⥅ related node [[community energy cumbria]]

⥅ related node [[community energy]]

⥅ related node [[community forests]]

⥅ related node [[community gardens]]

⥅ related node [[community land trusts]]

⥅ related node [[community memory]]

⥅ related node [[community mesh network]]

⥅ related node [[community networks]]

⥅ related node [[community of gardens]]

⥅ related node [[community of practice]]

⥅ related node [[community of praxis]]

⥅ related node [[community organising]]

⥅ related node [[community oriented life at human scale]]

⥅ related node [[community production coop]]

⥅ related node [[community repair]]

⥅ related node [[community technology partnerships]]

⥅ related node [[community washing]]

⥅ related node [[community wealth building 2 0]]

⥅ related node [[community wealth building]]

⥅ related node [[communityrule]]

⥅ related node [[comparing fedwiki and agora]]

⥅ related node [[comparing liberatory technology and appropriate technology]]

⥅ related node [[comparing liberatory technology and convivial tools]]

⥅ related node [[comparing market state and commons]]

⥅ related node [[compassion]]

⥅ related node [[competitive compatibility]]

⥅ related node [[completion at point of roam links not working]]

⥅ related node [[complex adaptive systems systems thinking and agent based modeling]]

⥅ related node [[complex adaptive systems]]

⥅ related node [[complex systems]]

⥅ related node [[complex]]

⥅ related node [[complexity and the left]]

⥅ related node [[complexity economics]]

⥅ related node [[complexity science and commoning]]

⥅ related node [[complexity science and the left]]

⥅ related node [[complexity science]]

⥅ related node [[complexity theory]]

⥅ related node [[complicated vs complex]]

⥅ related node [[complicated]]

⥅ related node [[compost party]]

⥅ related node [[computing networks are social and political systems]]

⥅ related node [[concentrate and ask again]]

⥅ related node [[concept map]]

⥅ related node [[confederation and federation]]

⥅ related node [[conflict free replicated data types]]

⥅ related node [[conflict minerals]]

⥅ related node [[conjuncture]]

⥅ related node [[connected northern regions]]

⥅ related node [[connecting the dots]]

⥅ related node [[connecting zotero to koreader]]

⥅ related node [[connectivism]]

⥅ related node [[connectivity]]

⥅ related node [[consciously arranged society]]

⥅ related node [[consciousness raising]]

⥅ related node [[consensus]]

⥅ related node [[consent]]

⥅ related node [[conservation]]

⥅ related node [[consider phlebas]]

⥅ related node [[constellations]]

⥅ related node [[constitution of the united states]]

⥅ related node [[consul]]

⥅ related node [[consumer citizenship]]

⥅ related node [[consumer cooperatives]]

⥅ related node [[consumer price index]]

⥅ related node [[consumerism]]

⥅ related node [[consumption]]

⥅ related node [[contact microphone]]

⥅ related node [[contact tracing]]

⥅ related node [[contemporary black experimental music]]

⥅ related node [[content moderation in the agora]]

⥅ related node [[contribute freely]]

⥅ related node [[contributor covenant]]

⥅ related node [[contributory accounting]]

⥅ related node [[control of computing infrastructure]]

⥅ related node [[conversation theory]]

⥅ related node [[conversations with gamechangers cooperation jackson]]

⥅ related node [[conversations with gamechangers grassroots liberation]]

⥅ related node [[conversations with gamechangers]]

⥅ related node [[convert a folder of org files to markdown]]

⥅ related node [[converting an old laptop screen into a portable monitor]]

⥅ related node [[convivial tool]]

⥅ related node [[convivial tools for thought]]

⥅ related node [[coop incubators]]

⥅ related node [[cooperation hull]]

⥅ related node [[cooperation jackson and discos]]

⥅ related node [[cooperation jackson webinar]]

⥅ related node [[cooperation jackson]]

⥅ related node [[cooperation new orleans]]

⥅ related node [[cooperation uk]]

⥅ related node [[cooperative finance]]

⥅ related node [[cooperative ownership structures]]

⥅ related node [[cooperative values]]

⥅ related node [[cooperatives in rojava]]

⥅ related node [[coopolis]]

⥅ related node [[coops and commoning]]

⥅ related node [[coops and socialism]]

⥅ related node [[coops can turn in to bad actors if there is no culture of commoning]]

⥅ related node [[cop 21]]

⥅ related node [[cop 26]]

⥅ related node [[cop 27]]

⥅ related node [[cop 3]]

⥅ related node [[cop]]

⥅ related node [[cop26 dispatch w vijay prashad and chris saltmarsh]]

⥅ related node [[cop27 the future is solar but it won t be simple]]

⥅ related node [[cop27 the future is solar but it wont be simple]]

⥅ related node [[cops playing music to trigger copyright filters to avoid being filmed]]

⥅ related node [[copwatch]]

⥅ related node [[copyfarleft]]

⥅ related node [[copyleft is the software equivalent of right to repair]]

⥅ related node [[copyleft]]

⥅ related node [[cormorant]]

⥅ related node [[corona climate chronic emergency]]

⥅ related node [[coronavirus and 3d printing]]

⥅ related node [[coronavirus is the perfect disaster for disaster capitalism]]

⥅ related node [[coronavirus surveillance]]

⥅ related node [[coronavirus testing]]

⥅ related node [[coronavirus]]

⥅ related node [[corporate power]]

⥅ related node [[corporate state]]

⥅ related node [[corporate takeover of the social system]]

⥅ related node [[corralling a chorus of voices]]

⥅ related node [[corruption]]

⥅ related node [[cory doctorow on seizing the means of computation]]

⥅ related node [[cory doctorow on why the internet broke and how to fix it]]

⥅ related node [[cory doctorow the internet con how to seize the means of computation]]

⥅ related node [[cosmopod]]

⥅ related node [[cost of living campaigns should fight for a green transitio]]

⥅ related node [[cost of living campaigns should fight for a green transition]]

⥅ related node [[cost of living crisis]]

⥅ related node [[cost of living]]

⥅ related node [[cotech]]

⥅ related node [[cottingham europes biggest battery storage system switched on]]

⥅ related node [[council communism]]

⥅ related node [[council]]

⥅ related node [[councils]]

⥅ related node [[countdown to the climate summit 1 how did we get here]]

⥅ related node [[counter anti flancianism]]

⥅ related node [[counterantidisintermediation]]

⥅ related node [[counterculture]]

⥅ related node [[counterhegemony]]

⥅ related node [[counterpower]]

⥅ related node [[covid 19 will not just disappear]]

⥅ related node [[covid antiviral drugs]]

⥅ related node [[covid is surging in europe what does it mean for the uk]]

⥅ related node [[covid recovery group]]

⥅ related node [[covid vaccination]]

⥅ related node [[cozyweb]]

⥅ related node [[crabgrass]]

⥅ related node [[creamy vegetable vegan risotto]]

⥅ related node [[creating a digital commons]]

⥅ related node [[2022 12 13_19 53 59_screenshot]]

⥅ related node [[creative reuse of existing technology]]

⥅ related node [[creatively adapt renew]]

⥅ related node [[credit union]]

⥅ related node [[creeping rootstalk]]

⥅ related node [[crime]]

⥅ related node [[critical infrastructure lab]]

⥅ related node [[critical making]]

⥅ related node [[critical mass]]

⥅ related node [[critical perspectives on digital capitalism theories and praxis]]

⥅ related node [[critical race theory]]

⥅ related node [[critical search]]

⥅ related node [[critical systems thinking]]

⥅ related node [[critical theory]]

⥅ related node [[critique of techno feudal reason]]

⥅ related node [[critiques of horizontalism]]

⥅ related node [[critiques of social media]]

⥅ related node [[critiques of verticalism]]

⥅ related node [[crm]]

⥅ related node [[cron]]

⥅ related node [[cross bay walk]]

⥅ related node [[cross disciplinary learning]]

⥅ related node [[crowdfunding]]

⥅ related node [[crowds and party]]

⥅ related node [[cryosphere]]

⥅ related node [[cryptocommons]]

⥅ related node [[cryptocurrency]]

⥅ related node [[cryptonomicon]]

⥅ related node [[cs unplugged]]

⥅ related node [[css grid]]

⥅ related node [[ctrl s]]

⥅ related node [[cuba is a good model of a green society]]

⥅ related node [[cuba is the most sustainably developed country in the world]]

⥅ related node [[cuba is world leading in agroecology]]

⥅ related node [[cuba]]

⥅ related node [[cuban revolution]]

⥅ related node [[cuban socialism]]

⥅ related node [[cubas energy revolution]]

⥅ related node [[cubas life task]]

⥅ related node [[cultivate shared purpose and values]]

⥅ related node [[cultural evolution]]

⥅ related node [[cultural genocide]]

⥅ related node [[cultural hegemony]]

⥅ related node [[cultural imperialism]]

⥅ related node [[cultural marxist]]

⥅ related node [[cultural references]]

⥅ related node [[cultural revolution]]

⥅ related node [[cultural studies]]

⥅ related node [[culture and structure]]

⥅ related node [[culture industry]]

⥅ related node [[culture power and politics ecosocialism and degrowth]]

⥅ related node [[culture]]

⥅ related node [[cumberland]]

⥅ related node [[cumbria action for sustainability]]

⥅ related node [[cumbria coalmine]]

⥅ related node [[cumbria councils to be replaced by two authorities]]

⥅ related node [[cumbria county council launches legal action over shake up]]

⥅ related node [[cumbria county council]]

⥅ related node [[cumbria]]

⥅ related node [[cumbrian coalmine]]

⥅ related node [[curation]]

⥅ related node [[cyberflaneur]]

⥅ related node [[cybernetic revolutionaries]]

⥅ related node [[cybernetics]]

⥅ related node [[cyberpunks anxieties are urban decay corporate power and globalisation]]

⥅ related node [[cycling]]

⥅ related node [[dadaism]]

⥅ related node [[daemon]]

⥅ related node [[daft punk]]

⥅ related node [[daily mail]]

⥅ related node [[daisyworld]]

⥅ related node [[dan hind]]

⥅ related node [[dao]]

⥅ related node [[daphne oram]]

⥅ related node [[dare to repair how we broke the future]]

⥅ related node [[dark energy]]

⥅ related node [[dark forest]]

⥅ related node [[dat]]

⥅ related node [[data analytics]]

⥅ related node [[data assimilation]]

⥅ related node [[data broker]]

⥅ related node [[data centre]]

⥅ related node [[data colonialism]]

⥅ related node [[data commons are digital ecosocialism]]

⥅ related node [[data commons]]

⥅ related node [[data cooperative]]

⥅ related node [[data garden]]

⥅ related node [[data humanism]]

⥅ related node [[data transfer project]]

⥅ related node [[data trust]]

⥅ related node [[data value chains]]

⥅ related node [[data]]

⥅ related node [[datafication]]

⥅ related node [[datassette]]

⥅ related node [[david bollier p2p models interview on digital commons]]

⥅ related node [[david cameron]]

⥅ related node [[david fleming]]

⥅ related node [[david graeber]]

⥅ related node [[david harvey]]

⥅ related node [[david nemer]]

⥅ related node [[david peter stroh systems thinking for social change]]

⥅ related node [[david watson]]

⥅ related node [[de marketing capital]]

⥅ related node [[de marketing intellectual property]]

⥅ related node [[de marketing labor]]

⥅ related node [[de marketing land]]

⥅ related node [[debating eco socialist futures]]

⥅ related node [[debbie bookchin]]

⥅ related node [[debian]]

⥅ related node [[debt slavery]]

⥅ related node [[debt the first 5000 years]]

⥅ related node [[debt]]

⥅ related node [[decarbonisation]]

⥅ related node [[december 2016]]

⥅ related node [[december 2019]]

⥅ related node [[decentralisation]]

⥅ related node [[decentralised energy infrastructure]]

⥅ related node [[decentralised futures]]

⥅ related node [[decentralised governance]]

⥅ related node [[decentralised manufacture]]

⥅ related node [[decentralised telecommunications infrastructure]]

⥅ related node [[decentralised wiki]]

⥅ related node [[decentralized autonomous organisations]]

⥅ related node [[decentralized planning]]

⥅ related node [[decide madrid]]

⥅ related node [[decidim]]

⥅ related node [[decision and control]]

⥅ related node [[decision trees]]

⥅ related node [[declaration of digital autonomy]]

⥅ related node [[decode]]

⥅ related node [[decolonization is not a metaphor]]

⥅ related node [[decolonizing digital rights]]

⥅ related node [[dedan kimathi]]

⥅ related node [[deep adaptation]]

⥅ related node [[deep democracy]]

⥅ related node [[deep ecology]]

⥅ related node [[deepen communion with nature]]

⥅ related node [[definition]]

⥅ related node [[degrowth and ecosocialism jason hickel]]

⥅ related node [[degrowth and ecosocialism]]

⥅ related node [[degrowth communism]]

⥅ related node [[degrowth green energy social equity and circular economy]]

⥅ related node [[degrowth is an element within the broader struggle of ecosocialism]]

⥅ related node [[degrowth is required to reduce demand]]

⥅ related node [[degrowth vs eco modernism]]

⥅ related node [[degrowth]]

⥅ related node [[delay tolerant networks]]

⥅ related node [[delay]]

⥅ related node [[deleuze and guattari and complex systems]]

⥅ related node [[deleuze and guattari]]

⥅ related node [[delia derbyshire]]

⥅ related node [[demagogue]]

⥅ related node [[demarketisation]]

⥅ related node [[democracy for sale europe s first black leader tea with obama]]

⥅ related node [[democracy functions best at the level of the city]]

⥅ related node [[democracy is in retreat worldwide]]

⥅ related node [[democracy now]]

⥅ related node [[democratic associationalism]]

⥅ related node [[democratic confederalism]]

⥅ related node [[democratic control]]

⥅ related node [[democratic planning]]

⥅ related node [[democratic republic of congo]]

⥅ related node [[democratic rights of citizens]]

⥅ related node [[democratic socialism]]

⥅ related node [[denote]]

⥅ related node [[dependency theory]]

⥅ related node [[deprivatisation of the internet]]

⥅ related node [[deprivatisation]]

⥅ related node [[derek wall]]

⥅ related node [[derive]]

⥅ related node [[derril water solar park]]

⥅ related node [[deschooling society]]

⥅ related node [[design for a brain]]

⥅ related node [[design journeys through complex systems]]

⥅ related node [[design justice network]]

⥅ related node [[design justice]]

⥅ related node [[design patterns]]

⥅ related node [[design sprint]]

⥅ related node [[designing for intermittency]]

⥅ related node [[desire]]

⥅ related node [[destruction of wild habitats]]

⥅ related node [[determinism]]

⥅ related node [[deterritorialization]]

⥅ related node [[detournement]]

⥅ related node [[detroit community technology project]]

⥅ related node [[development]]

⥅ related node [[dialectical materialism]]

⥅ related node [[dialectics of nature]]

⥅ related node [[dialectics]]

⥅ related node [[dialogic]]

⥅ related node [[diane abbott]]

⥅ related node [[dictatorship of the proletariat]]

⥅ related node [[dielo trouda]]

⥅ related node [[difference and connection]]

⥅ related node [[diggers]]

⥅ related node [[digial capitalism course]]

⥅ related node [[digital action]]

⥅ related node [[digital activism]]

⥅ related node [[digital archaeology]]

⥅ related node [[digital architectures shadow all aspects of human life]]

⥅ related node [[digital autonomy]]

⥅ related node [[digital campfires]]

⥅ related node [[digital capitalism course overview]]

⥅ related node [[digital capitalism course]]

⥅ related node [[digital capitalism online course]]

⥅ related node [[digital cash]]

⥅ related node [[digital cold war]]

⥅ related node [[digital colonialism geopolitics of data and development]]

⥅ related node [[digital colonialism]]

⥅ related node [[digital community wealth building]]

⥅ related node [[digital companies support other forms of unsustainable extraction]]

⥅ related node [[digital counterpower]]

⥅ related node [[digital degrowth technology in the age of survival]]

⥅ related node [[digital degrowth]]

⥅ related node [[digital democracy manifesto]]

⥅ related node [[digital divide]]

⥅ related node [[digital eco socialism]]

⥅ related node [[digital economy]]

⥅ related node [[digital ecosocialism breaking the power of big tech]]

⥅ related node [[digital ecosocialism]]

⥅ related node [[digital emancipation]]

⥅ related node [[digital environmental footprint legislation]]

⥅ related node [[digital fabrication]]

⥅ related node [[digital finance]]

⥅ related node [[digital freedom fund]]

⥅ related node [[digital gardening practice]]

⥅ related node [[digital gardens and systems thinking]]

⥅ related node [[digital gated community]]

⥅ related node [[digital inclusion needs to be locally embedded]]

⥅ related node [[digital inclusion risks being paternalistic]]

⥅ related node [[digital inclusion]]

⥅ related node [[digital literacy]]

⥅ related node [[digital markets act]]

⥅ related node [[digital means of production]]

⥅ related node [[digital neighborhood watch]]

⥅ related node [[digital non aligned movement]]

⥅ related node [[digital ocean]]

⥅ related node [[digital participation]]

⥅ related node [[digital parties]]

⥅ related node [[digital psychogeography]]

⥅ related node [[digital public assets]]

⥅ related node [[digital regulation]]

⥅ related node [[digital revolution]]

⥅ related node [[digital revolutions activism in the internet age]]

⥅ related node [[digital rewilding]]

⥅ related node [[digital rights management]]

⥅ related node [[digital rights]]

⥅ related node [[digital scarcity]]

⥅ related node [[digital self determination]]

⥅ related node [[digital self governance]]

⥅ related node [[digital socialism]]

⥅ related node [[digital sovereignty]]

⥅ related node [[digital surveillance]]

⥅ related node [[digital taylorism]]

⥅ related node [[digital tech deal]]

⥅ related node [[digital technologies are an important part of movement infrastructure]]

⥅ related node [[digital technologies]]

⥅ related node [[digital technology]]

⥅ related node [[digital trade]]

⥅ related node [[digital urban planning]]

⥅ related node [[digital weeding and watering]]

⥅ related node [[digital welfare state]]

⥅ related node [[digital]]

⥅ related node [[digitalisation and the security state]]

⥅ related node [[digitalisation]]

⥅ related node [[digitalization and the anthropocene]]

⥅ related node [[digitalization]]

⥅ related node [[digitisation]]

⥅ related node [[dilemma prison]]

⥅ related node [[dino]]

⥅ related node [[direct action]]

⥅ related node [[direct air capture]]

⥅ related node [[direct democracy]]

⥅ related node [[disaster capitalism]]

⥅ related node [[disaster communism]]

⥅ related node [[disaster recovery]]

⥅ related node [[discard studies]]

⥅ related node [[disco manifesto]]

⥅ related node [[discussion of roam alternatives]]

⥅ related node [[disease]]

⥅ related node [[disinformation]]

⥅ related node [[2022 03 04_18 20 27_screenshot]]

⥅ related node [[dissolution of the soviet union]]

⥅ related node [[distributed action]]

⥅ related node [[distributed applications can only do what their protocols support]]

⥅ related node [[distributed cooperative organisation]]

⥅ related node [[distributed digital gardens]]

⥅ related node [[distributed hash table]]

⥅ related node [[distributed ledger]]

⥅ related node [[distributed ledgers and commoning]]

⥅ related node [[distributed wikis on solid]]

⥅ related node [[district heating]]

⥅ related node [[dmca 1201]]

⥅ related node [[dmca]]

⥅ related node [[dmytri kleiner]]

⥅ related node [[do you like likes]]

⥅ related node [[documentation is praxis]]

⥅ related node [[does keepassxc work with passkeys]]

⥅ related node [[doing the doughnut tech]]

⥅ related node [[domination]]

⥅ related node [[dominic cummings]]

⥅ related node [[donald trump]]

⥅ related node [[donella meadows]]

⥅ related node [[donna harraway]]

⥅ related node [[dont buy from amazon]]

⥅ related node [[dont look up]]

⥅ related node [[dont pay uk]]

⥅ related node [[doom emacs]]

⥅ related node [[dortmund]]

⥅ related node [[double entry bookeeping]]

⥅ related node [[double loop learning]]

⥅ related node [[doubleloop net]]

⥅ related node [[doubleloop todo]]

⥅ related node [[doublescores]]

⥅ related node [[doughnut economics action lab]]

⥅ related node [[doughnut economics]]

⥅ related node [[doughnut model]]

⥅ related node [[douglass]]

⥅ related node [[downscaling]]

⥅ related node [[dr holly jean buck]]

⥅ related node [[drake equation]]

⥅ related node [[drax]]

⥅ related node [[drew pendergrass and troy vettese on half earth socialism]]

⥅ related node [[drew pendergrass]]

⥅ related node [[drift]]

⥅ related node [[driverless cars]]

⥅ related node [[drivers seat cooperative]]

⥅ related node [[drought]]

⥅ related node [[dual power]]

⥅ related node [[dualism]]

⥅ related node [[dukkha]]

⥅ related node [[dulongderosnay2020 digital commons]]

⥅ related node [[duplicator]]

⥅ related node [[durability]]

⥅ related node [[2020 05 31_11 38 27_2hrf3ly]]

⥅ related node [[dynabook]]

⥅ related node [[dynamic knowledge repository]]

⥅ related node [[dynamic planning]]

⥅ related node [[dynamics]]

⥅ related node [[dyne org]]

⥅ related node [[e f schumacher]]

⥅ related node [[e o wilson]]

⥅ related node [[e waste]]

⥅ related node [[early 1990s britain]]

⥅ related node [[early humans]]

⥅ related node [[early life]]

⥅ related node [[earth after climate collapse]]

⥅ related node [[earth charter]]

⥅ related node [[earth first]]

⥅ related node [[earth system]]

⥅ related node [[earth]]

⥅ related node [[east coker t s eliot]]

⥅ related node [[east coker]]

⥅ related node [[eat sleep protest repeat]]

⥅ related node [[eben moglen]]

⥅ related node [[eco anxiety]]

⥅ related node [[eco apartheid]]

⥅ related node [[eco futurist]]

⥅ related node [[eco leninism]]

⥅ related node [[eco modernism]]

⥅ related node [[eco nihilism]]

⥅ related node [[eco socialism and technology]]

⥅ related node [[eco socialism]]

⥅ related node [[eco socialist]]

⥅ related node [[eco terrorism]]

⥅ related node [[ecodesign directive]]

⥅ related node [[ecodesign for sustainable products regulation]]

⥅ related node [[ecodesign]]

⥅ related node [[ecofascism]]

⥅ related node [[ecofeminism]]

⥅ related node [[ecoliteracy]]

⥅ related node [[ecological civilization]]

⥅ related node [[ecological flows]]

⥅ related node [[ecological leninism with kai heron]]

⥅ related node [[ecological marxism]]

⥅ related node [[ecological radio workshop]]

⥅ related node [[ecology and revolutionary thought]]

⥅ related node [[ecology of technology]]

⥅ related node [[ecology]]

⥅ related node [[ecomodernism]]

⥅ related node [[economic calculation in the socialist commonwealth]]

⥅ related node [[economic disobedience]]

⥅ related node [[economic justice goes hand in hand with social justice]]

⥅ related node [[economic plan and calculation in kind]]

⥅ related node [[economic policy in response to big tech must go beyond data]]

⥅ related node [[economic power]]

⥅ related node [[economic reproduction]]

⥅ related node [[economic theory]]

⥅ related node [[economics for emancipation]]

⥅ related node [[economics]]

⥅ related node [[economies of scale]]

⥅ related node [[economies of scope]]

⥅ related node [[economism]]

⥅ related node [[economys domination of social life]]

⥅ related node [[ecosocialism 2023]]

⥅ related node [[ecosocialism and degrowth]]

⥅ related node [[ecosocialism and the ecological crisis]]

⥅ related node [[ecosocialism and the technoprogressive perspective]]

⥅ related node [[ecosocialism]]

⥅ related node [[2023 05 08_20 32 56_screenshot]]

⥅ related node [[ecosocialist technology]]

⥅ related node [[ecosocialist transition]]

⥅ related node [[ecosocialist]]

⥅ related node [[ecosystems services]]

⥅ related node [[ecosystems]]

⥅ related node [[ecuador]]

⥅ related node [[ed milliband]]

⥅ related node [[ed straw]]

⥅ related node [[eden medina]]

⥅ related node [[edgar morin]]

⥅ related node [[editable software]]

⥅ related node [[edri]]

⥅ related node [[eduardo mondlane]]

⥅ related node [[educate agitate organise]]

⥅ related node [[edward bellamy]]

⥅ related node [[edward colston]]

⥅ related node [[edward jenner]]

⥅ related node [[edward ongweso jr]]

⥅ related node [[eee]]

⥅ related node [[effecting change]]

⥅ related node [[effective freedom]]

⥅ related node [[eight design principles for successful commons]]

⥅ related node [[einstein]]

⥅ related node [[ela kagel]]

⥅ related node [[eldridge cleaver]]

⥅ related node [[election extra nigel farage is back]]

⥅ related node [[electoral politics]]

⥅ related node [[electoral theory and strategy of marx and lenin w august nimtz]]

⥅ related node [[electoralism]]

⥅ related node [[electric cars]]

⥅ related node [[electrify everything]]

⥅ related node [[electronic waste]]

⥅ related node [[electronics supply chains]]

⥅ related node [[electronics watch]]

⥅ related node [[elfeed]]

⥅ related node [[eliezer yudkowsky]]

⥅ related node [[elinor ostroms rules for radicals]]

⥅ related node [[elisp koans]]

⥅ related node [[elite]]

⥅ related node [[elixir]]

⥅ related node [[eliza]]

⥅ related node [[ellie]]

⥅ related node [[elon musk]]

⥅ related node [[elon musks takeover of twitter]]

⥅ related node [[elysium fire]]

⥅ related node [[emacs and agency]]

⥅ related node [[emacs blog carnival maintenance]]

⥅ related node [[emacs carnival maintenance]]

⥅ related node [[emacs carnival org babel]]

⥅ related node [[emacs carnival praise the patchers]]

⥅ related node [[emacs carnival]]

⥅ related node [[emacs dead and loving it]]

⥅ related node [[emacs for writing]]

⥅ related node [[emacs freex]]

⥅ related node [[emacs from scratch]]

⥅ related node [[emacs lisp]]

⥅ related node [[emacs note taking systems]]

⥅ related node [[emacs wiki]]

⥅ related node [[emacsconf 2020]]

⥅ related node [[emancipation]]

⥅ related node [[embodiment]]

⥅ related node [[emergent outline]]

⥅ related node [[emergent outlines]]

⥅ related node [[emergent revolution]]

⥅ related node [[emergent strategy]]

⥅ related node [[emilia romagna]]

⥅ related node [[emma goldman]]

⥅ related node [[emmet]]

⥅ related node [[emory douglas]]

⥅ related node [[empire]]

⥅ related node [[enclosure movement]]

⥅ related node [[enclosure of the commons]]

⥅ related node [[enclosure of the data commons]]

⥅ related node [[enclosure of the digital commons]]

⥅ related node [[enclosure of the gardens]]

⥅ related node [[enclosure]]

⥅ related node [[encommuns]]

⥅ related node [[end of history]]

⥅ related node [[end of the world end of the month one fight]]

⥅ related node [[ende gelande]]

⥅ related node [[energy bills]]

⥅ related node [[energy company profits]]

⥅ related node [[energy coop]]

⥅ related node [[energy development]]

⥅ related node [[energy efficiency]]

⥅ related node [[energy from waste]]

⥅ related node [[energy industry]]

⥅ related node [[energy is going to have to be rationed]]

⥅ related node [[energy price freeze]]

⥅ related node [[energy price freezes are a direct result of campaigning like dont pay uk]]

⥅ related node [[energy quotas]]

⥅ related node [[energy storage]]

⥅ related node [[energy studies]]

⥅ related node [[england coast path]]

⥅ related node [[england]]

⥅ related node [[english councils are battling financial ruin]]

⥅ related node [[english councils]]

⥅ related node [[english water industry]]

⥅ related node [[enid]]

⥅ related node [[enshittification]]

⥅ related node [[enslavement]]

⥅ related node [[ensure repair can be performed at a fair price]]

⥅ related node [[entropy and the capitalist system with robert biel]]

⥅ related node [[environment nature]]

⥅ related node [[environment variables]]

⥅ related node [[environmental impact of the web]]

⥅ related node [[environmental impact]]

⥅ related node [[environmental politics]]

⥅ related node [[environmentalism]]

⥅ related node [[envisioning platform socialism w james muldoon]]

⥅ related node [[envisioning real utopias from within the capitalist present]]

⥅ related node [[envisioning real utopias]]

⥅ related node [[epeat]]

⥅ related node [[epicyon]]

⥅ related node [[epidemiology]]

⥅ related node [[epistemic disclosure]]

⥅ related node [[epistemology vs ontology]]

⥅ related node [[epistemology]]

⥅ related node [[epub]]

⥅ related node [[equality]]

⥅ related node [[equation based modelling]]

⥅ related node [[equitable internet initiative]]

⥅ related node [[erc]]

⥅ related node [[eric klinenberg]]

⥅ related node [[erik albers]]

⥅ related node [[erik olin wright]]

⥅ related node [[eroding capitalism]]

⥅ related node [[erp]]

⥅ related node [[error invalid type in command series from org super agenda]]

⥅ related node [[error lib x86 64 linux gnu libc so 6 version glibc 2 28 not found]]

⥅ related node [[error u130 on canon pixma mg6150]]

⥅ related node [[errors migrating a wordpress site from mysql 5 7 to 8 via duplicator]]

⥅ related node [[ert]]

⥅ related node [[escaping capitalism]]

⥅ related node [[ethical consumerism]]

⥅ related node [[ethical issues in ai]]

⥅ related node [[ethical source movement]]

⥅ related node [[ethics and second order cybernetics]]

⥅ related node [[europe]]

⥅ related node [[european commission]]

⥅ related node [[european green deal]]

⥅ related node [[european research group]]

⥅ related node [[european union]]

⥅ related node [[eusocial]]

⥅ related node [[evergreen notes]]

⥅ related node [[every billionaire is a policy failure]]

⥅ related node [[everyday communism]]

⥅ related node [[everyday utopia and radical imagination with kristen ghodsee]]

⥅ related node [[everyday utopia]]

⥅ related node [[everything is social]]

⥅ related node [[evgeny morozov competition and cooperation in digital capitalism]]

⥅ related node [[evgeny morozov]]

⥅ related node [[eviction ban]]

⥅ related node [[evil escape]]

⥅ related node [[evo morales]]

⥅ related node [[evolutionary and adaptive systems]]

⥅ related node [[evolutionary biology]]

⥅ related node [[exchange value]]

⥅ related node [[exit to community]]

⥅ related node [[exiting the vampire castle]]

⥅ related node [[exomemory]]

⥅ related node [[expand democracy into the workplace]]

⥅ related node [[explained how are the myanmar protests being organized]]

⥅ related node [[exploitation of workers during coronavirus]]

⥅ related node [[exploitation]]

⥅ related node [[exporting highlights and notes from koreader]]

⥅ related node [[exposition]]

⥅ related node [[expropriation of the commons]]

⥅ related node [[extensive revolution]]

⥅ related node [[extinction rebellion]]

⥅ related node [[extractivism]]

⥅ related node [[extreme heat in the worlds oceans passed the point of no return in 2014]]

⥅ related node [[extreme heat prompts first ever amazon delivery driver strike]]

⥅ related node [[extremism]]

⥅ related node [[extropians]]

⥅ related node [[f droid]]

⥅ related node [[fab lab]]

⥅ related node [[fabian society]]

⥅ related node [[fablab]]

⥅ related node [[fabrication]]

⥅ related node [[face off the government versus gps]]

⥅ related node [[facebook bulletin]]

⥅ related node [[facebook only cares about money]]

⥅ related node [[facebook outage 2021]]

⥅ related node [[facebook share drop]]

⥅ related node [[fail2ban]]

⥅ related node [[failed to install org roam package compat 28 1 0 4 is unavailable]]

⥅ related node [[fair data]]

⥅ related node [[fairbnb]]

⥅ related node [[fairphone]]

⥅ related node [[fairtec]]

⥅ related node [[faiza shaheen]]

⥅ related node [[fake news]]

⥅ related node [[false consciousness]]

⥅ related node [[farmbot]]

⥅ related node [[farming]]

⥅ related node [[fastmail]]

⥅ related node [[fatah]]

⥅ related node [[favela]]

⥅ related node [[fbi]]

⥅ related node [[federacion anarquista uruguaya]]

⥅ related node [[federal trade commission]]

⥅ related node [[federated education new directions in digital collaboration]]

⥅ related node [[federated wikis]]

⥅ related node [[fediverse governance]]

⥅ related node [[fedora]]

⥅ related node [[feeling]]

⥅ related node [[felix guattari]]

⥅ related node [[felt]]

⥅ related node [[feminism]]

⥅ related node [[feminist economics]]

⥅ related node [[feminist tech]]

⥅ related node [[feminist]]

⥅ related node [[feudal internet]]

⥅ related node [[feudalism]]

⥅ related node [[fibonacci numbers]]

⥅ related node [[fidel castro]]

⥅ related node [[field recording]]

⥅ related node [[figures such as colston are not simply remote characters from history]]

⥅ related node [[figuring out org roam bibtex]]

⥅ related node [[file error getting attributes permission denied run user 1001 emacs]]

⥅ related node [[page 01]]

⥅ related node [[page 02]]

⥅ related node [[page 03]]

⥅ related node [[page 04]]

⥅ related node [[page 05]]

⥅ related node [[page 06]]

⥅ related node [[page 07]]

⥅ related node [[page 08]]

⥅ related node [[page 09]]

⥅ related node [[page 10]]

⥅ related node [[page 11]]

⥅ related node [[page 12]]

⥅ related node [[page 13]]

⥅ related node [[page 14]]

⥅ related node [[page 15]]

⥅ related node [[page 1]]

⥅ related node [[page 2]]

⥅ related node [[page 3]]

⥅ related node [[page 4]]

⥅ related node [[page 5]]

⥅ related node [[page 6]]

⥅ related node [[page 7]]

⥅ related node [[page 8]]

⥅ related node [[2020 03 05]]

⥅ related node [[noodlemaps]]

⥅ related node [[film theory]]

⥅ related node [[film]]

⥅ related node [[filter bubble]]

⥅ related node [[filtering algorithms]]

⥅ related node [[finance capital]]

⥅ related node [[finance commons provisioning]]

⥅ related node [[finding books without claims in org roam using org babel and sqlite]]

⥅ related node [[first and last men]]

⥅ related node [[first and third world ecosocialisms]]

⥅ related node [[first international]]

⥅ related node [[fiscal hosting]]

⥅ related node [[fish]]

⥅ related node [[five principles of a socialist climate politics]]

⥅ related node [[fixfest uk 2023]]

⥅ related node [[fixing a christmas jumper with lights in it]]

⥅ related node [[fixing a vtech my laptop]]

⥅ related node [[fixing at rhino camp refugee settlement]]

⥅ related node [[fixing factories and were off]]

⥅ related node [[fixing factory]]

⥅ related node [[fixing my sites urls]]

⥅ related node [[fixing plantuml in org babel]]

⥅ related node [[fixing rclone google drive oauth issue]]

⥅ related node [[flancia collective and the spheres of commoning]]

⥅ related node [[flancia meet 2022 01 08]]

⥅ related node [[flancian neil 2021 12 11]]

⥅ related node [[flat pay structure]]

⥅ related node [[fleeting notes]]

⥅ related node [[flickering]]

⥅ related node [[flock]]

⥅ related node [[flows of value]]

⥅ related node [[fluxus]]

⥅ related node [[folders]]

⥅ related node [[folgezettel makes you consider your new notes more carefully]]

⥅ related node [[folgezettel]]

⥅ related node [[folk politics]]

⥅ related node [[follow the city leader the power of local action on the climate crisis]]

⥅ related node [[following twitter people via nitter and miniflux]]

⥅ related node [[food banks]]

⥅ related node [[food commons]]

⥅ related node [[food is a human right not a commodity]]

⥅ related node [[food strategy for england likely to be watered down]]

⥅ related node [[food waste]]

⥅ related node [[food webs]]

⥅ related node [[food]]

⥅ related node [[for a red zoopolis]]

⥅ related node [[for an anti colonial anti racist environmentalism]]

⥅ related node [[for big tech user benefits are secondary to business model]]

⥅ related node [[for every problem offer a solution]]

⥅ related node [[for profit healthcare systems are a piece of shit]]

⥅ related node [[forces of production]]

⥅ related node [[fordism]]

⥅ related node [[forest and factory]]

⥅ related node [[forest of bowland]]

⥅ related node [[forever computer]]

⥅ related node [[forgejo]]

⥅ related node [[forget eco modernism]]

⥅ related node [[formal subsumption]]

⥅ related node [[formation of earth]]

⥅ related node [[foss and crafts]]

⥅ related node [[foss]]

⥅ related node [[fossil capital]]

⥅ related node [[foundations of geopolitics]]

⥅ related node [[four day week]]

⥅ related node [[four freedoms]]

⥅ related node [[four in five britons want the government to do more to support repair]]

⥅ related node [[four thousand weeks]]

⥅ related node [[four types of anti capitalism]]

⥅ related node [[fourth industrial revolution]]

⥅ related node [[foxconn]]

⥅ related node [[foxglove]]

⥅ related node [[fracking]]

⥅ related node [[fractal dimension]]

⥅ related node [[fractals]]

⥅ related node [[fractures internationalist teach ins]]

⥅ related node [[fragment on machines]]

⥅ related node [[fragments vertebrate technology]]

⥅ related node [[framasoft]]

⥅ related node [[framework laptop]]

⥅ related node [[framing device]]

⥅ related node [[framing]]

⥅ related node [[france]]

⥅ related node [[francis bacon]]

⥅ related node [[francis spufford]]

⥅ related node [[frankenstein]]

⥅ related node [[frankfurt school]]

⥅ related node [[frantz fanon against facebook how to decolonize your digital mind]]

⥅ related node [[fred hampton]]

⥅ related node [[fred moten]]

⥅ related node [[frederic jameson]]

⥅ related node [[frederick douglass]]

⥅ related node [[fredric jameson]]

⥅ related node [[free and open source software]]

⥅ related node [[free association of producers]]

⥅ related node [[free basics]]

⥅ related node [[free communities]]

⥅ related node [[free culture]]

⥅ related node [[free market economy]]

⥅ related node [[free market]]

⥅ related node [[free software affords digital self governance]]

⥅ related node [[free software and mutual aid]]

⥅ related node [[free software becomes a standard in dortmund germany]]

⥅ related node [[free software economics]]

⥅ related node [[free software governance]]

⥅ related node [[free software is a gift economy]]

⥅ related node [[free software licensing]]

⥅ related node [[free software project management]]

⥅ related node [[free will]]

⥅ related node [[freedom under capitalism]]

⥅ related node [[freegle]]

⥅ related node [[freeing ourselves from the clutches of big tech]]

⥅ related node [[freemans wood]]

⥅ related node [[freifunk]]

⥅ related node [[french repair index]]

⥅ related node [[french revolution]]

⥅ related node [[freud]]

⥅ related node [[friedrich hayek]]

⥅ related node [[friends of the earth]]

⥅ related node [[fritjof capra]]

⥅ related node [[from apple to anomaly]]

⥅ related node [[from each according to their ability to each according to their need]]

⥅ related node [[fsfe]]

⥅ related node [[fuel poverty action]]

⥅ related node [[full of noises]]

⥅ related node [[fully automated luxury communism]]

⥅ related node [[fully transcluded backlinks]]

⥅ related node [[functional hierarchy]]

⥅ related node [[funding free software]]

⥅ related node [[fungi]]

⥅ related node [[furness citizens jury on climate change]]

⥅ related node [[furness]]

⥅ related node [[future histories]]

⥅ related node [[g d h cole]]

⥅ related node [[g20]]

⥅ related node [[gabriel boric]]

⥅ related node [[gaia hypothesis]]

⥅ related node [[galaksija]]

⥅ related node [[galileo]]

⥅ related node [[garden circle]]

⥅ related node [[garden reader]]

⥅ related node [[gardening]]

⥅ related node [[gardens and streams ii]]

⥅ related node [[gardens and streams indieweb session]]

⥅ related node [[garrett hardin]]

⥅ related node [[gavin mueller]]

⥅ related node [[gaza]]

⥅ related node [[gdp]]

⥅ related node [[gdpr]]

⥅ related node [[geeks for social change]]

⥅ related node [[geist]]

⥅ related node [[gender fluid]]

⥅ related node [[gender identity]]

⥅ related node [[gene culture coevolution]]

⥅ related node [[general agreement on tariffs and trade]]

⥅ related node [[general agreement on trade and tariffs]]

⥅ related node [[general election 2019]]

⥅ related node [[general idea of the revolution in the twenty first century]]

⥅ related node [[general intellect unit 038 the viable system model]]

⥅ related node [[general intellect unit 066 post open source]]

⥅ related node [[general intellect unit the cybernetic brain part 1 ontological theatre]]

⥅ related node [[general intellect unit]]

⥅ related node [[general intellect]]

⥅ related node [[general strike]]

⥅ related node [[generative ai has a ferocious environmental impact]]

⥅ related node [[generative ai is further concentrating power with big tech]]

⥅ related node [[generative ai]]

⥅ related node [[generative art]]

⥅ related node [[generative interoperability]]

⥅ related node [[geoengineering]]

⥅ related node [[geoff hinton]]

⥅ related node [[geoff mann]]

⥅ related node [[geology]]

⥅ related node [[geopolitics]]

⥅ related node [[george floyd]]

⥅ related node [[george monbiot]]

⥅ related node [[george orwell]]

⥅ related node [[geosphere]]

⥅ related node [[german greens]]

⥅ related node [[german revolution]]

⥅ related node [[gestalt]]

⥅ related node [[getting a phone]]

⥅ related node [[getting knowledge maps in to my weeknotes]]

⥅ related node [[gevulot]]

⥅ related node [[ghosts in the machines artificial intelligence consciousness capitalism]]

⥅ related node [[gift culture]]

⥅ related node [[gift economies build community]]

⥅ related node [[gift economies]]

⥅ related node [[gilbert simondon]]

⥅ related node [[gilets jaunes]]

⥅ related node [[gini coefficient]]

⥅ related node [[gitflow]]

⥅ related node [[github copilot]]

⥅ related node [[glam]]

⥅ related node [[glamorous toolkit]]

⥅ related node [[gleaning]]

⥅ related node [[glitch and detournement]]

⥅ related node [[glitch feminism]]

⥅ related node [[glitch gallery]]

⥅ related node [[global boiling]]

⥅ related node [[global commons alliance]]

⥅ related node [[global debt peonage]]

⥅ related node [[global ecosystems]]

⥅ related node [[global food system]]

⥅ related node [[global heating]]

⥅ related node [[global north]]

⥅ related node [[global politics]]

⥅ related node [[global south]]

⥅ related node [[global surface temperature]]

⥅ related node [[global temperature]]

⥅ related node [[global warming policy foundation]]

⥅ related node [[global warming]]

⥅ related node [[globalization]]

⥅ related node [[gnd summer book club]]

⥅ related node [[gnd vs degrowth live panel from labour conference 2021]]

⥅ related node [[gnu general public license]]

⥅ related node [[go big 2 a big idea to rethink the economy]]

⥅ related node [[goalist]]

⥅ related node [[god is change]]

⥅ related node [[goldman sachs doesnt care if you raise chickens]]

⥅ related node [[good annotations are better than the original]]

⥅ related node [[goodbye islave]]

⥅ related node [[google and right to repair]]

⥅ related node [[google fonts]]

⥅ related node [[google joins samsung in working with ifixit on a self repair program]]

⥅ related node [[google pixel 5a]]

⥅ related node [[google scholar alternatives]]

⥅ related node [[google scholar]]

⥅ related node [[google will sell pixel batteries repair parts to customers]]

⥅ related node [[google won t repair cracked pixel watch screens]]

⥅ related node [[google wont repair cracked pixel watch screens]]

⥅ related node [[gordon pask]]

⥅ related node [[gosplan]]

⥅ related node [[gosplant]]

⥅ related node [[gossip protocol]]

⥅ related node [[goteo]]

⥅ related node [[governable spaces]]

⥅ related node [[governable stacks against digital colonialism]]

⥅ related node [[governable stacks]]

⥅ related node [[governable]]

⥅ related node [[governance commons]]

⥅ related node [[governance is the extension of whiteness on a global scale]]

⥅ related node [[governing complex economies and societies by consent is hard]]

⥅ related node [[governing the information commons]]

⥅ related node [[grace blakeley]]

⥅ related node [[grace lee boggs]]

⥅ related node [[graham jones]]

⥅ related node [[graham]]

⥅ related node [[graphic novel]]

⥅ related node [[grasmere]]

⥅ related node [[grassroots liberation]]

⥅ related node [[grassroots organising 101 w sasha josette and olly armstrong]]

⥅ related node [[great acceleration]]

⥅ related node [[great leap forward]]

⥅ related node [[great society]]

⥅ related node [[greater london council]]

⥅ related node [[greater london enterprise board]]

⥅ related node [[greater manchester cooperative commission]]

⥅ related node [[greed]]

⥅ related node [[green alliance]]

⥅ related node [[green capitalism]]

⥅ related node [[green computing]]

⥅ related node [[green cuba]]

⥅ related node [[green energy]]

⥅ related node [[green growth]]

⥅ related node [[green housing]]

⥅ related node [[green hydrogen]]

⥅ related node [[green imperialism]]

⥅ related node [[green investment fund]]

⥅ related node [[green jobs]]

⥅ related node [[green new deal]]

⥅ related node [[green politics]]

⥅ related node [[green socialist notes decentralization 101]]

⥅ related node [[green society]]

⥅ related node [[green software legislation]]

⥅ related node [[green transition]]

⥅ related node [[greenhost]]

⥅ related node [[greenhouse gas emissions]]

⥅ related node [[greenhouse gas protocol]]

⥅ related node [[greening government ict and digital services strategy 2020 2025]]

⥅ related node [[greenspace hack]]

⥅ related node [[gregor love]]

⥅ related node [[grey literature]]

⥅ related node [[grey walter]]

⥅ related node [[greyball]]

⥅ related node [[grid balancing]]

⥅ related node [[grid]]

⥅ related node [[gross domestic product]]

⥅ related node [[gross national happiness]]

⥅ related node [[group model building]]

⥅ related node [[grover]]

⥅ related node [[growing older]]

⥅ related node [[growth]]

⥅ related node [[growthism]]

⥅ related node [[grozny]]

⥅ related node [[grundrisse]]

⥅ related node [[gtd horizons of focus]]

⥅ related node [[guake]]

⥅ related node [[guardians of the galaxy]]

⥅ related node [[guernica]]

⥅ related node [[guerrilla history]]

⥅ related node [[guerrilla media collective]]

⥅ related node [[guerrilla technology]]

⥅ related node [[guild socialism]]

⥅ related node [[guile]]

⥅ related node [[guitar]]

⥅ related node [[guix]]

⥅ related node [[gus woody]]

⥅ related node [[gustavo petro]]

⥅ related node [[guy debord]]

⥅ related node [[h g wells]]

⥅ related node [[h t odums environment power and society]]

⥅ related node [[habitat loss]]

⥅ related node [[hacker class]]

⥅ related node [[hackerspace]]

⥅ related node [[hacking for the commons]]

⥅ related node [[hacklabs and hackerspaces tracing two genealogies]]

⥅ related node [[hadas thier]]

⥅ related node [[haitian revolution]]

⥅ related node [[half earth]]

⥅ related node [[half nelson]]

⥅ related node [[half of the worlds population is highly vulnerable to the climate crisis]]

⥅ related node [[halt and catch fire]]

⥅ related node [[hamas]]

⥅ related node [[hannah fry]]

⥅ related node [[happy planet index]]

⥅ related node [[hardt and negri]]

⥅ related node [[has there been a purge of the leftwing of the labour party]]

⥅ related node [[haunt]]

⥅ related node [[hawkeye]]

⥅ related node [[hazardous waste]]

⥅ related node [[healthcare in england]]

⥅ related node [[heat exchanger]]

⥅ related node [[heat or eat]]

⥅ related node [[heat pumps]]

⥅ related node [[hegel]]

⥅ related node [[hegemony of liberalism]]

⥅ related node [[hegemony]]

⥅ related node [[heinz von foerster]]

⥅ related node [[heirloom computer]]

⥅ related node [[heliboard]]

⥅ related node [[hello world book]]

⥅ related node [[henrik huseby]]

⥅ related node [[herbert marcuse]]

⥅ related node [[here comes the sun storing clean energy]]

⥅ related node [[herman daly]]

⥅ related node [[heroism]]

⥅ related node [[heros journey]]

⥅ related node [[hes material]]

⥅ related node [[hes sections]]

⥅ related node [[hetzner]]

⥅ related node [[heysham]]

⥅ related node [[hierarchical note taking]]

⥅ related node [[his dark materials]]

⥅ related node [[historical materialism]]

⥅ related node [[history shows radical futures are possible w lizzie oshea]]

⥅ related node [[hledger]]

⥅ related node [[hoad hill]]

⥅ related node [[hobbesianism]]

⥅ related node [[holarchy]]

⥅ related node [[hold my stafford beer]]

⥅ related node [[hold my stafford]]

⥅ related node [[hole punching]]

⥅ related node [[holly jean buck]]

⥅ related node [[holocene]]

⥅ related node [[holochain and basic income]]

⥅ related node [[holochain and commoning]]

⥅ related node [[holochain]]

⥅ related node [[homebrew commons club]]

⥅ related node [[homebrew computer club]]

⥅ related node [[homebrew website club]]

⥅ related node [[homelessness]]

⥅ related node [[homeostasis]]

⥅ related node [[hope]]

⥅ related node [[horizontalism]]

⥅ related node [[hotel bar sessions breaking things at work with gavin mueller]]

⥅ related node [[hotel bar sessions immediacy with anna kornbluh]]

⥅ related node [[hotel bar sessions late capitalism]]

⥅ related node [[hotel bar sessions revolutionary mathematics]]

⥅ related node [[hotel bar sessions the stories we tell]]

⥅ related node [[hotel bar sessions trust]]

⥅ related node [[hotel bar sessions whose anthropocene]]

⥅ related node [[hotel bar sessions]]

⥅ related node [[household waste]]

⥅ related node [[houses of culture]]

⥅ related node [[how a local government migrated to open source]]

⥅ related node [[how an infamous ransomware gang found itself hacked]]

⥅ related node [[how are the mahsa amini protests being organised]]

⥅ related node [[how barnsleys pioneering community energy scheme tackled fuel poverty]]

⥅ related node [[how can i use spaced repetition]]

⥅ related node [[how can we achieve vaccine equity]]

⥅ related node [[how could we study climate related social innovation applying deleuzean philosophy to the transition towns]]

⥅ related node [[how degrowth will save the world with jason hickel]]

⥅ related node [[how did i get into electronic music]]

⥅ related node [[how does linking digital gardens facilitate a richer commons]]

⥅ related node [[how i capture fleeting notes]]

⥅ related node [[how i log the data from our repair cafe]]

⥅ related node [[how i publish my digital garden to the web with org publish]]

⥅ related node [[how i publish my org roam digital garden to the web with org publish]]

⥅ related node [[how i publish my wiki with org publish]]

⥅ related node [[how i take notes]]

⥅ related node [[how local councils are acting on climate]]

⥅ related node [[how not to deal with big tech]]

⥅ related node [[how personal is a personal wiki]]

⥅ related node [[how public common partnerships can help us take back whats ours]]

⥅ related node [[how should you structure a personal wiki]]

⥅ related node [[how swiss women won a landmark climate case for europe]]

⥅ related node [[how systems theory can help us reflect on the world]]

⥅ related node [[how the north plunders the south w jason hickel]]

⥅ related node [[how the world became uninsurable]]

⥅ related node [[how to actively thwart enclosure and cooptation of the digital commons]]

⥅ related node [[how to be an anticapitalist in the twenty first century]]

⥅ related node [[how to blow up a data centre]]

⥅ related node [[how to blow up a pipeline]]

⥅ related node [[how to build a new world in the shell of the old]]

⥅ related node [[how to feed the world without destroying it]]

⥅ related node [[how to follow me]]

⥅ related node [[how to get rss feeds of facebook pages]]

⥅ related node [[how to have device specific values in dir locals el]]

⥅ related node [[how to help gnu emacs maintainers]]

⥅ related node [[how to make a pencil]]

⥅ related node [[how to stop a data center]]

⥅ related node [[how to talk about avoiding waste with keep britain tidy]]

⥅ related node [[how we built community wealth in preston]]

⥅ related node [[how we can encode human rights in the blockchain]]

⥅ related node [[how we show up with mia birdsong]]

⥅ related node [[how would you include free software in community wealth building]]

⥅ related node [[how would you link indieweb and agora]]

⥅ related node [[how would you make a local first indieweb]]

⥅ related node [[howard zinn]]

⥅ related node [[howl poem]]

⥅ related node [[hows that open source governance working for you]]

⥅ related node [[hp 655]]

⥅ related node [[hp officejet 4620]]

⥅ related node [[hp stream]]

⥅ related node [[https]]

⥅ related node [[huey p newton]]

⥅ related node [[huffduffer]]

⥅ related node [[hugelkultur]]

⥅ related node [[huginn]]

⥅ related node [[hugo blanco]]

⥅ related node [[human activity]]

⥅ related node [[human development index]]

⥅ related node [[human evolution]]

⥅ related node [[human nature]]

⥅ related node [[human physiology]]

⥅ related node [[humans are eusocial animals]]

⥅ related node [[humberto maturana]]

⥅ related node [[hurrah sapphire moon]]

⥅ related node [[hurricane sandy]]

⥅ related node [[hydrogen planes]]

⥅ related node [[hydrophone]]

⥅ related node [[hydrosphere]]

⥅ related node [[hyper commonplace garden wiki]]

⥅ related node [[hyperconversations]]

⥅ related node [[hyperdrive]]

⥅ related node [[hyperinflation]]

⥅ related node [[hyperland]]

⥅ related node [[hypermedia]]

⥅ related node [[hypermodernity]]

⥅ related node [[hyperscheduling]]

⥅ related node [[hypertext as a thought construction kit]]

⥅ related node [[hypertexting]]

⥅ related node [[hyphalinks]]

⥅ related node [[hyphapunk]]

⥅ related node [[i am a socialist]]

⥅ related node [[i am an ecosocialist]]

⥅ related node [[i am]]

⥅ related node [[i cant believe its not science]]

⥅ related node [[i dislike big tech]]

⥅ related node [[i dislike capitalism]]

⥅ related node [[i dont like capitalism]]

⥅ related node [[i got a new second hand phone]]

⥅ related node [[i have benefitted hugely from free software]]

⥅ related node [[i like agroecology]]

⥅ related node [[i like buzzards]]

⥅ related node [[i like free software]]

⥅ related node [[i like gift economies]]

⥅ related node [[i like solarpunk]]

⥅ related node [[i like the commons]]

⥅ related node [[i like]]

⥅ related node [[i love podcasts]]

⥅ related node [[i love the lake district]]

⥅ related node [[i love]]

⥅ related node [[i strongly dislike the policing bill]]

⥅ related node [[i strongly dislike]]

⥅ related node [[i want a community not an audience]]

⥅ related node [[iain m banks]]

⥅ related node [[ict a top horizontal priority in sustainable product policy]]

⥅ related node [[ict and planetary boundaries]]

⥅ related node [[ict is a fundamental part of modern society]]

⥅ related node [[ict]]

⥅ related node [[icts have a significant role in the means of production]]

⥅ related node [[idea webs]]

⥅ related node [[ideology]]

⥅ related node [[if we burn]]

⥅ related node [[ifixit and lenovo]]

⥅ related node [[ifixit]]

⥅ related node [[ile sans fil]]

⥅ related node [[illusion of knowing]]

⥅ related node [[imagenet]]

⥅ related node [[adorno]]

⥅ related node [[agitate]]

⥅ related node [[baudrillard]]

⥅ related node [[capital is dead glitch]]

⥅ related node [[climate lenin]]

⥅ related node [[20201010_141447]]

⥅ related node [[goldsworthy]]

⥅ related node [[goldsworthy2]]

⥅ related node [[heather]]

⥅ related node [[peak]]

⥅ related node [[complex systems organizational map]]

⥅ related node [[deleuze guatarri]]

⥅ related node [[digital ecosocialism blurt 2024 11 09]]

⥅ related node [[earth at night]]

⥅ related node [[earthsea map]]

⥅ related node [[ecology blurt 2024 11 10]]

⥅ related node [[educate]]

⥅ related node [[indiewebcamp gardenandstream]]

⥅ related node [[jane jacobs]]

⥅ related node [[hp stream exploded display]]

⥅ related node [[hp stream exploded]]

⥅ related node [[local graph view]]

⥅ related node [[miller wiki]]

⥅ related node [[my garden]]

⥅ related node [[myst]]

⥅ related node [[neither vertical nor horizontal]]

⥅ related node [[neuranim]]

⥅ related node [[organise]]

⥅ related node [[postmodernism jameson]]

⥅ related node [[resonate owner]]

⥅ related node [[rhizome network]]

⥅ related node [[rojava]]

⥅ related node [[evolution new caldav calendar]]

⥅ related node [[nextcloud caldav link]]

⥅ related node [[nextcloud carddav link]]

⥅ related node [[nextcloud contacts download]]

⥅ related node [[nextcloud contacts import]]

⥅ related node [[nextcloud import]]

⥅ related node [[seven coop principles]]

⥅ related node [[simulacra and simulation]]

⥅ related node [[space cats]]

⥅ related node [[structuralism]]

⥅ related node [[temperature since 1ad]]

⥅ related node [[the stream]]

⥅ related node [[tons pkm]]

⥅ related node [[two loop model]]

⥅ related node [[vectoralism]]

⥅ related node [[imagining social movements from networks to dynamic systems]]

⥅ related node [[imago machine]]

⥅ related node [[immanence and transcendence]]

⥅ related node [[immanence]]

⥅ related node [[2020 06 15_20 39 53_300px a_thaliana_metabolic_network]]

⥅ related node [[immanuel wallerstein]]

⥅ related node [[immediacy]]

⥅ related node [[immediatism 690 debord ressentiment revolutionary anarchism by aragorn]]

⥅ related node [[immediatism 691 preface to the society of the spectacle by ken knabb]]

⥅ related node [[immediatism]]

⥅ related node [[immune system]]

⥅ related node [[impact investing]]

⥅ related node [[imperialism is the arsonist of our fires and savannas]]

⥅ related node [[imperialism is the arsonist of our forests and savannas]]

⥅ related node [[imperialism]]

⥅ related node [[implicit feudalism]]

⥅ related node [[importmagic and or epc not found]]

⥅ related node [[2020 05 08_16 29 24_screenshot]]

⥅ related node [[2020 05 08_16 29 47_screenshot]]

⥅ related node [[improving my emacs writing mode]]

⥅ related node [[improving my note taking]]

⥅ related node [[in and against the state]]

⥅ related node [[in natura planning]]

⥅ related node [[in our time the enclosures of the 18th century]]

⥅ related node [[income equality will always result in political inequality]]

⥅ related node [[income]]

⥅ related node [[incrementalism]]

⥅ related node [[independent repair]]

⥅ related node [[independent repairers]]

⥅ related node [[index page for my journal files]]

⥅ related node [[india]]

⥅ related node [[indian workers association]]

⥅ related node [[indie thinker]]

⥅ related node [[indieforums]]

⥅ related node [[indienet]]

⥅ related node [[indieweb and personal wikis]]

⥅ related node [[indieweb carnival]]

⥅ related node [[indiewebcamp]]

⥅ related node [[indiewebifying event discovery and rsvps]]

⥅ related node [[indigenous and traditional ecological knowledge]]

⥅ related node [[indigenous communities on ownership and governance]]

⥅ related node [[indigenous culture]]

⥅ related node [[indigenous struggles]]

⥅ related node [[indigenous]]

⥅ related node [[individualism]]

⥅ related node [[indonesian communist party]]

⥅ related node [[industrial platforms]]

⥅ related node [[industrial revolution]]

⥅ related node [[industrial waste]]

⥅ related node [[industrial workers of the world]]

⥅ related node [[industrialisation]]

⥅ related node [[indymedia]]

⥅ related node [[inequality]]

⥅ related node [[infinite detail]]

⥅ related node [[inflation reduction act]]

⥅ related node [[influence maps]]

⥅ related node [[influencer]]

⥅ related node [[info daemons]]

⥅ related node [[informatics]]

⥅ related node [[information access]]

⥅ related node [[information age]]

⥅ related node [[information and communication technology]]

⥅ related node [[information and communications technology]]

⥅ related node [[information asymmetry]]

⥅ related node [[information capitalism]]

⥅ related node [[information civics]]

⥅ related node [[information literacy]]

⥅ related node [[information overload]]

⥅ related node [[information society]]

⥅ related node [[information strategies]]

⥅ related node [[information strategy]]

⥅ related node [[information superhighway]]

⥅ related node [[information technology and socialist construction]]

⥅ related node [[information technology underpins much of modern life]]

⥅ related node [[information technology]]

⥅ related node [[information theory]]

⥅ related node [[information warfare]]

⥅ related node [[infoshop]]

⥅ related node [[infrastructure as code]]

⥅ related node [[infrastructure]]

⥅ related node [[initiative]]

⥅ related node [[inner garden]]

⥅ related node [[innovation]]

⥅ related node [[insecurity]]

⥅ related node [[inside the ai factory the humans that make tech seem human]]

⥅ related node [[inside the real repair shop 7]]

⥅ related node [[installing and setting up koreader on my kobo]]

⥅ related node [[installing emacs from source]]

⥅ related node [[installing lineageos on samsung galaxy s5]]

⥅ related node [[institute for social ecology online courses]]

⥅ related node [[institute for social ecology]]

⥅ related node [[institutional analysis and development]]

⥅ related node [[insulate britain]]

⥅ related node [[insulation]]

⥅ related node [[insurance pools]]

⥅ related node [[insurgency]]

⥅ related node [[integrated assessment models]]

⥅ related node [[intellectual property markets must be socialized]]

⥅ related node [[intellectual property]]

⥅ related node [[intensive revolution]]

⥅ related node [[inter brain zettelkasten]]

⥅ related node [[interactions]]

⥅ related node [[interactive fiction]]

⥅ related node [[interactive journey]]

⥅ related node [[interest rate]]

⥅ related node [[interfacer]]

⥅ related node [[interlinking wikis]]

⥅ related node [[international monetary fund]]

⥅ related node [[international relations]]

⥅ related node [[international repair day]]

⥅ related node [[international telecommunication union]]

⥅ related node [[internet cube]]

⥅ related node [[internet enclosure w ben tarnoff]]

⥅ related node [[internet for the people]]

⥅ related node [[internet of things]]

⥅ related node [[internet protocol suite]]

⥅ related node [[interoperability]]

⥅ related node [[interregnum]]

⥅ related node [[intersection of class politics and environmental politics]]

⥅ related node [[intersectionality]]

⥅ related node [[intertextuality]]

⥅ related node [[interwiki]]

⥅ related node [[introduction to complexity]]

⥅ related node [[invasion of ukraine]]

⥅ related node [[inventing the future]]

⥅ related node [[invidious]]

⥅ related node [[ip address space]]

⥅ related node [[ipact]]

⥅ related node [[ipbes]]

⥅ related node [[ipcc sixth assessment report]]

⥅ related node [[ipcc]]

⥅ related node [[iphone 13]]

⥅ related node [[ippr]]

⥅ related node [[iran]]

⥅ related node [[iraq war]]

⥅ related node [[irc bouncer]]

⥅ related node [[iron age]]

⥅ related node [[is ai about to steal your job]]

⥅ related node [[is fairtec a vanguard stack]]

⥅ related node [[is free software anarchist]]

⥅ related node [[is free software communist]]

⥅ related node [[is libre the same as governable]]

⥅ related node [[is micro making the future]]

⥅ related node [[is open street map a data commons]]

⥅ related node [[is post structuralist political theory anarchist]]

⥅ related node [[is the indieweb too hard to use]]

⥅ related node [[is the middle east on the brink]]

⥅ related node [[is the phrase digital colonialism problematic]]

⥅ related node [[is the uk heading for a recession]]

⥅ related node [[is there a connection between prefiguration and vanguardism]]

⥅ related node [[isabelle stengers]]

⥅ related node [[islavery]]

⥅ related node [[isle of dogs]]

⥅ related node [[isle of man]]

⥅ related node [[isms and itys]]

⥅ related node [[isotypes]]

⥅ related node [[israel s ai kill list once you go automatic target generation goes crazy]]

⥅ related node [[israel]]

⥅ related node [[issue identification]]

⥅ related node [[issue when updating spacemacs failed to checkout evil impaired]]

⥅ related node [[issue with evil escape in doom on termux]]

⥅ related node [[it s not rocket science it s just community radical ffestiniog]]

⥅ related node [[italian communist party]]

⥅ related node [[iterated prisoners dilemma]]

⥅ related node [[iterative inquiry]]

⥅ related node [[its eco socialism or death]]

⥅ related node [[its not about your footprint its about your point of leverage]]

⥅ related node [[its not in covid 19s own interests to become more mild over time]]

⥅ related node [[its time to bring energy into public ownership]]

⥅ related node [[ivan illich]]

⥅ related node [[iwc utrecht]]

⥅ related node [[iww]]

⥅ related node [[jack qiu]]

⥅ related node [[jack stilgoe]]

⥅ related node [[jackson kush plan]]

⥅ related node [[jackson rising redux]]

⥅ related node [[jackson rising]]

⥅ related node [[jacky alcine]]

⥅ related node [[jacobin]]

⥅ related node [[jacquard loom]]

⥅ related node [[jakarta is coming]]

⥅ related node [[jamaican maroons]]

⥅ related node [[james bridle]]

⥅ related node [[james lovelock]]

⥅ related node [[james meadway]]

⥅ related node [[james muldoon]]

⥅ related node [[jan boddez]]

⥅ related node [[jane]]

⥅ related node [[janos kornai]]

⥅ related node [[jason hickel]]

⥅ related node [[jason w moore]]

⥅ related node [[jathan sadowski]]

⥅ related node [[jean baudrillard]]

⥅ related node [[jean jacques rousseau]]

⥅ related node [[jean paul marat]]

⥅ related node [[jeff bezos]]

⥅ related node [[jennerite ecological scepticism]]

⥅ related node [[jeremy corbyn mhairi black left culled centre cracked and right reformed]]

⥅ related node [[jeremy corbyn]]

⥅ related node [[jeremy gilbert]]

⥅ related node [[jeremy hunt s election budget for big earners and big owners]]

⥅ related node [[jeremy lent wisdom traditions science the search for meaning]]

⥅ related node [[jeremy lent]]

⥅ related node [[jessica gordon nembhard]]

⥅ related node [[jimi hendrix]]

⥅ related node [[joanne anderson]]

⥅ related node [[job guarantee]]

⥅ related node [[jodi dean]]

⥅ related node [[joe biden]]

⥅ related node [[joey ayoub]]

⥅ related node [[john bellamy foster]]

⥅ related node [[john fahey]]

⥅ related node [[john locke]]

⥅ related node [[john oswald]]

⥅ related node [[joker]]

⥅ related node [[jordan petersen]]

⥅ related node [[jorn bettin]]

⥅ related node [[jose luis vivero pol treating food as commons not commodites]]

⥅ related node [[jose luis vivero pol]]

⥅ related node [[joseph beuys]]

⥅ related node [[joseph rowntree foundation]]

⥅ related node [[joseph weizenbaum]]

⥅ related node [[josh lepawsky]]

⥅ related node [[journal article]]

⥅ related node [[journal of peer production]]

⥅ related node [[journal pages]]

⥅ related node [[2021 04 04]]

⥅ related node [[2021 04 26]]

⥅ related node [[2021 05 18]]

⥅ related node [[2021 06 17]]

⥅ related node [[2021 08 24]]

⥅ related node [[2021 09 09]]

⥅ related node [[2021 10 25]]

⥅ related node [[2021 11 03]]

⥅ related node [[2021 11 09]]

⥅ related node [[2021 12 06]]

⥅ related node [[2021 12 07]]

⥅ related node [[2021 12 20]]

⥅ related node [[2021 12 23_17 19 39_screenshot]]

⥅ related node [[2021 12 23_17 20 01_screenshot]]

⥅ related node [[2022 02 03]]

⥅ related node [[2022 02 05]]

⥅ related node [[2022 02 22]]

⥅ related node [[2022 04 04]]

⥅ related node [[2022 04 10]]

⥅ related node [[2022 04 18]]

⥅ related node [[2022 04 19]]

⥅ related node [[2022 04 21]]

⥅ related node [[2022 04 26]]

⥅ related node [[2022 07 14]]

⥅ related node [[2022 07 26]]

⥅ related node [[2022 10 07]]

⥅ related node [[2022 11 12]]

⥅ related node [[2022 11 21]]

⥅ related node [[2023 02 13]]

⥅ related node [[2023 02 24]]

⥅ related node [[2023 03 05]]

⥅ related node [[2023 06 21]]

⥅ related node [[2023 07 07]]

⥅ related node [[2023 07 28]]

⥅ related node [[2023 08 15]]

⥅ related node [[2023 10 26]]

⥅ related node [[2023 11 06]]

⥅ related node [[2023 11 07]]

⥅ related node [[2023 11 08]]

⥅ related node [[2023 11 09]]

⥅ related node [[2023 11 10]]

⥅ related node [[2023 11 12]]

⥅ related node [[2023 11 13]]

⥅ related node [[2023 11 14]]

⥅ related node [[2023 11 15]]

⥅ related node [[2023 11 16]]

⥅ related node [[2023 11 17]]

⥅ related node [[2023 11 22]]

⥅ related node [[2023 11 23]]

⥅ related node [[2023 11 27]]

⥅ related node [[2023 12 10]]

⥅ related node [[2024 01 24]]

⥅ related node [[2024 01 29]]

⥅ related node [[2024 02 02]]

⥅ related node [[2024 02 08]]

⥅ related node [[2024 02 09]]

⥅ related node [[2024 02 11]]

⥅ related node [[2024 02 14]]

⥅ related node [[2024 02 18]]

⥅ related node [[2024 02 21]]

⥅ related node [[2024 02 22]]

⥅ related node [[2024 02 27]]

⥅ related node [[2024 02 28]]

⥅ related node [[2024 02 29]]

⥅ related node [[2024 03 14]]

⥅ related node [[2024 03 19]]

⥅ related node [[2024 03 22]]

⥅ related node [[2024 03 23]]

⥅ related node [[2024 03 24]]

⥅ related node [[2024 03 25]]

⥅ related node [[2024 03 27]]

⥅ related node [[2024 03 29]]

⥅ related node [[2024 03 30]]

⥅ related node [[2024 03 31]]

⥅ related node [[2024 04 02]]

⥅ related node [[2024 04 03]]

⥅ related node [[2024 04 04]]

⥅ related node [[2024 04 06]]

⥅ related node [[2024 04 07]]

⥅ related node [[2024 04 08]]

⥅ related node [[2024 04 09]]

⥅ related node [[2024 04 10]]

⥅ related node [[2024 04 12]]

⥅ related node [[2024 04 13]]

⥅ related node [[2024 04 16]]

⥅ related node [[2024 04 17]]

⥅ related node [[2024 04 19]]

⥅ related node [[2024 04 20]]

⥅ related node [[2024 04 21]]

⥅ related node [[2024 04 22]]

⥅ related node [[2024 04 23]]

⥅ related node [[2024 04 26]]

⥅ related node [[2024 04 28]]

⥅ related node [[2024 05 19]]

⥅ related node [[2024 05 20]]

⥅ related node [[2024 05 22]]

⥅ related node [[2024 05 26]]

⥅ related node [[2024 06 02]]

⥅ related node [[2024 06 05]]

⥅ related node [[2024 06 07]]

⥅ related node [[2024 10 30]]

⥅ related node [[2024 11 07]]

⥅ related node [[2024 11 13]]

⥅ related node [[2024 11 14]]

⥅ related node [[2024 11 18]]

⥅ related node [[2024 11 21]]

⥅ related node [[2024 11 25]]

⥅ related node [[2024 11 29]]

⥅ related node [[2024 12 01]]

⥅ related node [[2024 12 03]]

⥅ related node [[2024 12 04]]

⥅ related node [[2024 12 05]]

⥅ related node [[2024 12 07]]

⥅ related node [[2024 12 09]]

⥅ related node [[2024 12 11]]

⥅ related node [[2024 12 14]]

⥅ related node [[2024 12 16]]

⥅ related node [[2024 12 19]]

⥅ related node [[2024 12 30]]

⥅ related node [[2025 01 02]]

⥅ related node [[2025 01 07]]

⥅ related node [[2025 01 24]]

⥅ related node [[2025 01 31]]

⥅ related node [[2025 02 01]]

⥅ related node [[2025 02 15]]

⥅ related node [[2025 03 08]]

⥅ related node [[2025 03 18]]

⥅ related node [[2025 03 27]]

⥅ related node [[2025 03 28]]

⥅ related node [[2025 04 03]]

⥅ related node [[2025 04 04]]

⥅ related node [[2025 04 05]]

⥅ related node [[2025 04 06]]

⥅ related node [[2025 04 07]]

⥅ related node [[2025 04 09]]

⥅ related node [[2025 04 10]]

⥅ related node [[2025 04 15]]

⥅ related node [[2025 04 26]]

⥅ related node [[2025 04 27]]

⥅ related node [[2025 05 03]]

⥅ related node [[2025 05 04]]

⥅ related node [[2025 05 10]]

⥅ related node [[2025 05 11]]

⥅ related node [[2025 05 14]]

⥅ related node [[2025 05 23]]

⥅ related node [[2025 05 25]]

⥅ related node [[2025 05 26]]

⥅ related node [[2025 05 29]]

⥅ related node [[2025 05 30]]

⥅ related node [[2025 06 01]]

⥅ related node [[2025 06 02]]

⥅ related node [[2025 06 03]]

⥅ related node [[2025 06 06]]

⥅ related node [[2025 06 07]]

⥅ related node [[2025 06 08]]

⥅ related node [[2025 06 09]]

⥅ related node [[2025 06 10]]

⥅ related node [[2025 06 13]]

⥅ related node [[2025 06 14]]

⥅ related node [[2025 06 15]]

⥅ related node [[2025 06 16]]

⥅ related node [[2025 06 19]]

⥅ related node [[2025 06 20]]

⥅ related node [[2025 06 22]]

⥅ related node [[2025 06 25]]

⥅ related node [[2025 06 29]]

⥅ related node [[2025 06 30]]

⥅ related node [[2025 07 03]]

⥅ related node [[2025 07 04]]

⥅ related node [[2025 07 05]]

⥅ related node [[2025 07 17]]

⥅ related node [[2025 08 03]]

⥅ related node [[2025 09 16]]

⥅ related node [[2025 10 30]]

⥅ related node [[2025 10 31]]

⥅ related node [[2025 11 01]]

⥅ related node [[2025 11 09]]

⥅ related node [[2025 11 10]]

⥅ related node [[2025 11 11]]

⥅ related node [[2025 11 21]]

⥅ related node [[2025 11 22]]

⥅ related node [[2025 11 30]]

⥅ related node [[2025 12 03]]

⥅ related node [[2025 12 07]]

⥅ related node [[annulled by gusts]]

⥅ related node [[current reading 2020 12 26]]

⥅ related node [[reframing tech]]

⥅ related node [[2021 10 16_14 12 54_screenshot]]

⥅ related node [[2021 10 16_14 15 27_screenshot]]

⥅ related node [[2021 10 16_14 17 04_screenshot]]

⥅ related node [[2021 10 16_14 17 45_screenshot]]

⥅ related node [[2021 10 16_14 27 40_screenshot]]

⥅ related node [[2022 09 26_18 14 55_screenshot]]

⥅ related node [[2022 09 26_18 16 21_screenshot]]

⥅ related node [[2022 09 26_18 18 21_screenshot]]

⥅ related node [[2022 09 26_18 20 16_screenshot]]

⥅ related node [[2022 09 26_18 23 51_screenshot]]

⥅ related node [[journees nationales de la reparation]]

⥅ related node [[judi bari]]

⥅ related node [[jugaad]]

⥅ related node [[julia salazar]]

⥅ related node [[july 2020]]

⥅ related node [[jura federation]]

⥅ related node [[jurassic world]]

⥅ related node [[just stop oil]]

⥅ related node [[just transition fund]]

⥅ related node [[just transition]]

⥅ related node [[k2pdfopt]]

⥅ related node [[k9]]

⥅ related node [[kafka]]

⥅ related node [[kai heron]]

⥅ related node [[kaizen]]

⥅ related node [[kali akuno]]

⥅ related node [[karl kautsky]]

⥅ related node [[karl polanyi]]

⥅ related node [[karrot]]

⥅ related node [[kartoffeln und computer]]

⥅ related node [[kate raworth on why our times demand doughnut economics]]

⥅ related node [[kate raworth]]

⥅ related node [[katherine trebeck]]

⥅ related node [[kaweah colony]]

⥅ related node [[keep commons commerce distinct]]

⥅ related node [[keep it in the community]]

⥅ related node [[keepass]]

⥅ related node [[keepassdx]]

⥅ related node [[keir milburn]]

⥅ related node [[keir starmer is a bit dull]]

⥅ related node [[keir starmer]]

⥅ related node [[ken knabb]]

⥅ related node [[ken macleod]]

⥅ related node [[kenyas informal settlements]]

⥅ related node [[kerala]]

⥅ related node [[kevin carson]]

⥅ related node [[keynesianism]]

⥅ related node [[keystone species]]

⥅ related node [[keystroke patterns as biometric profiling]]

⥅ related node [[khrushchev]]

⥅ related node [[kicks condor]]

⥅ related node [[kill the bill]]

⥅ related node [[kill the ecomodernist in your head]]

⥅ related node [[kim stanley robinson]]

⥅ related node [[kingfishers]]

⥅ related node [[kinneavy triangle]]

⥅ related node [[kinnu]]

⥅ related node [[knowle west media centre]]

⥅ related node [[knowledge class]]

⥅ related node [[knowledge commoner]]

⥅ related node [[knowledge commoning]]

⥅ related node [[knowledge cycle]]

⥅ related node [[knowledge economy]]

⥅ related node [[knowledge gardening]]

⥅ related node [[knowledge graph]]

⥅ related node [[knowledge sharing]]

⥅ related node [[knowledge worker]]

⥅ related node [[kobo]]

⥅ related node [[kohei saito climate crisis and ecological revolution]]

⥅ related node [[kohei saito on degrowth communism]]

⥅ related node [[kohei saito]]

⥅ related node [[kohighlights]]

⥅ related node [[komplexitat chaostheorie und die linke]]

⥅ related node [[koreader]]

⥅ related node [[kristen ghodsee]]

⥅ related node [[kristin ross]]

⥅ related node [[kyiv]]

⥅ related node [[kyoto protocol]]

⥅ related node [[la borde]]

⥅ related node [[labor markets]]

⥅ related node [[labour market]]

⥅ related node [[labour markets must be socialized]]

⥅ related node [[labour movement]]

⥅ related node [[labour party]]

⥅ related node [[labour theory of value]]

⥅ related node [[labour under keir starmer]]

⥅ related node [[labour]]

⥅ related node [[labours green policies]]

⥅ related node [[laissez faire economics]]

⥅ related node [[lake baikal]]

⥅ related node [[lake district]]

⥅ related node [[lancashire]]

⥅ related node [[lancaster]]

⥅ related node [[land and freedom]]

⥅ related node [[land markets must be socialized]]

⥅ related node [[land markets]]

⥅ related node [[land reform]]

⥅ related node [[land rights]]

⥅ related node [[land use]]

⥅ related node [[landfill]]

⥅ related node [[langdon winner]]

⥅ related node [[laptop power supply]]

⥅ related node [[laptop repair]]

⥅ related node [[laravel]]

⥅ related node [[late capitalism]]

⥅ related node [[late devonian extinction]]

⥅ related node [[laurie spiegel]]

⥅ related node [[lavender]]

⥅ related node [[law of requisite variety]]

⥅ related node [[layer 0]]

⥅ related node [[layer infinity]]

⥅ related node [[leaf]]

⥅ related node [[lean logic]]

⥅ related node [[lean platforms]]

⥅ related node [[learning blurt]]

⥅ related node [[learning from indigenous culture]]

⥅ related node [[learning in public]]

⥅ related node [[learning science]]

⥅ related node [[lee felsenstein]]

⥅ related node [[lee patterson]]

⥅ related node [[left bloc w james schneider]]

⥅ related node [[left melancholia]]

⥅ related node [[left spirituality]]

⥅ related node [[left tech festivals]]

⥅ related node [[left tech magazines]]

⥅ related node [[leftist politics]]

⥅ related node [[legacy social media]]

⥅ related node [[legislation]]

⥅ related node [[leighton moss]]

⥅ related node [[lend engine]]

⥅ related node [[lene andersen metamodernity meaning and hope in a complex world]]

⥅ related node [[leninism]]

⥅ related node [[leninist]]

⥅ related node [[lenovo ideapad 100s]]

⥅ related node [[lenovo thinkpad t450s]]

⥅ related node [[lenovo]]

⥅ related node [[leo vivier]]

⥅ related node [[leonid kantorovich]]

⥅ related node [[less insidious more invidious improving my video embeds]]

⥅ related node [[less is more]]

⥅ related node [[lets encrypt certificate renewal issue]]

⥅ related node [[levellers]]

⥅ related node [[levelling up]]

⥅ related node [[leven estuary]]

⥅ related node [[leverage point modeling]]

⥅ related node [[leverage points analysis]]

⥅ related node [[leverage points places to intervene in a system]]

⥅ related node [[leverage points]]

⥅ related node [[lewis mumford]]

⥅ related node [[liberation theology]]

⥅ related node [[liberation]]

⥅ related node [[liberatory fintech]]

⥅ related node [[liberatory software]]

⥅ related node [[libertarian marxist]]

⥅ related node [[libertarian municipalism]]

⥅ related node [[libertarian socialism]]

⥅ related node [[libertarian socialist]]

⥅ related node [[liberty]]

⥅ related node [[libraries]]

⥅ related node [[library of things]]

⥅ related node [[libre hardware]]

⥅ related node [[libre]]

⥅ related node [[libreoffice]]

⥅ related node [[libro fm]]

⥅ related node [[lichen]]

⥅ related node [[lida pesa]]

⥅ related node [[life happens]]

⥅ related node [[life inside gaza during 11 days of bombardment]]

⥅ related node [[life of galileo]]

⥅ related node [[life stack]]

⥅ related node [[lifecycle of emergence using emergence to take social innovation to scale]]

⥅ related node [[lifecycle of information]]

⥅ related node [[lindenmeyer systems]]

⥅ related node [[lineageos]]

⥅ related node [[linear economy]]

⥅ related node [[linear programming]]

⥅ related node [[lines of flight]]

⥅ related node [[linkedin]]

⥅ related node [[linux day to day notes]]

⥅ related node [[linux mint]]

⥅ related node [[linux terminal app for android]]

⥅ related node [[lisbon]]

⥅ related node [[liss c werner cybernetics state of the art]]

⥅ related node [[listen notes]]

⥅ related node [[listened]]

⥅ related node [[literate configuration]]

⥅ related node [[literate programming]]

⥅ related node [[literate publish el]]

⥅ related node [[literature notes]]

⥅ related node [[404 page not found]]

⥅ related node [[a cooperative vision for technological innovation w dan hind]]

⥅ related node [[can municipal socialism be labour s defence against ongoing austerity]]

⥅ related node [[hail the maintainers]]

⥅ related node [[how blogs broke the web]]

⥅ related node [[how nostalgia serves corporate power w grafton tanner]]

⥅ related node [[informatics of the oppressed]]

⥅ related node [[new uk tech regulator to limit power of google and facebook]]

⥅ related node [[online communities are still catching up to my mothers garden club]]

⥅ related node [[privacy censorship and social media the case for a common platform]]

⥅ related node [[rediscovering the small web]]

⥅ related node [[rewilding the web]]

⥅ related node [[smooth co operators the power of co ops to transform society]]

⥅ related node [[the web we have to save]]

⥅ related node [[lithium]]

⥅ related node [[lithosphere]]

⥅ related node [[little red songbook]]

⥅ related node [[liverpool]]

⥅ related node [[lizzie oshea]]

⥅ related node [[local action]]

⥅ related node [[local communities are the primary organisms within human society]]

⥅ related node [[local currencies]]

⥅ related node [[local currency]]

⥅ related node [[local first software]]

⥅ related node [[localism]]

⥅ related node [[lockbit]]

⥅ related node [[locnet]]

⥅ related node [[logic magazine]]

⥅ related node [[logics of resistance]]

⥅ related node [[logistic model]]

⥅ related node [[loki]]

⥅ related node [[lonely crowds]]

⥅ related node [[long covid]]

⥅ related node [[long term availability of spare parts]]

⥅ related node [[long term computing]]

⥅ related node [[longo mai]]

⥅ related node [[look to windward]]

⥅ related node [[looking backward]]

⥅ related node [[looks like new can business account for care work]]

⥅ related node [[looks like new can software handle ethics]]

⥅ related node [[looks like new]]

⥅ related node [[lorea]]

⥅ related node [[lorenzo komboa ervin]]

⥅ related node [[loss and damage]]

⥅ related node [[loss of biodiversity]]

⥅ related node [[loughrigg fell]]

⥅ related node [[loughrigg tarn]]

⥅ related node [[low tech]]

⥅ related node [[lucas aerospace]]

⥅ related node [[luddism]]

⥅ related node [[luddites]]

⥅ related node [[ludwig von mises]]

⥅ related node [[lumpenproletariat]]

⥅ related node [[machine learning algorithms]]

⥅ related node [[machinery]]

⥅ related node [[macros]]

⥅ related node [[made myself a logo with plantuml]]

⥅ related node [[maggie appleton on open source as a gift economy]]

⥅ related node [[magit performance on minified js and css]]

⥅ related node [[magit]]

⥅ related node [[magna carta]]

⥅ related node [[magnetosphere]]

⥅ related node [[mahsa amini protests]]

⥅ related node [[maidan revolution]]

⥅ related node [[maintainers anonymous]]

⥅ related node [[maintek]]

⥅ related node [[make a map not a tracing]]

⥅ related node [[make rojava green again]]

⥅ related node [[making a recent changes page on my wiki]]

⥅ related node [[making connections]]

⥅ related node [[making it]]

⥅ related node [[malcolm blaney]]

⥅ related node [[malcolm x grassroots movement]]

⥅ related node [[malthusianism]]

⥅ related node [[mammoth solar]]

⥅ related node [[management cybernetics]]

⥅ related node [[manchester central library]]

⥅ related node [[manchester]]

⥅ related node [[mandrake linux]]

⥅ related node [[manston]]

⥅ related node [[manuel castells]]

⥅ related node [[manufactured islaves]]

⥅ related node [[manufacturers and the right to repair]]

⥅ related node [[manufacturers are joining the fight for repair]]

⥅ related node [[manufacturing islaves]]

⥅ related node [[many to many communication]]

⥅ related node [[mao]]

⥅ related node [[maoism]]

⥅ related node [[maori]]

⥅ related node [[mapeo]]

⥅ related node [[march 2020]]

⥅ related node [[march to end fossil fuels]]

⥅ related node [[marcora law]]

⥅ related node [[marea]]

⥅ related node [[margaret thatcher]]

⥅ related node [[margaret wheatley]]

⥅ related node [[marginalism]]

⥅ related node [[maria spiridonova]]

⥅ related node [[mariana mazzucato]]

⥅ related node [[mark fisher]]

⥅ related node [[mark jenkinson]]

⥅ related node [[mark zuckerberg]]

⥅ related node [[market anarchism]]

⥅ related node [[market economy]]

⥅ related node [[market socialism]]

⥅ related node [[market society]]

⥅ related node [[market]]

⥅ related node [[markets after capitalism]]

⥅ related node [[markets before capitalism]]

⥅ related node [[markets dont give you what you need they give you what you can afford]]

⥅ related node [[markets for goods and services are compatible with socialism]]

⥅ related node [[markets for goods and services]]

⥅ related node [[markets in the next system]]

⥅ related node [[markets vs planning]]

⥅ related node [[markets]]

⥅ related node [[marking up wiki pages with microformats]]

⥅ related node [[marsh harrier]]

⥅ related node [[marvel cinematic universe]]

⥅ related node [[marx and technology]]

⥅ related node [[marx for beginners]]

⥅ related node [[marxian analysis of christmas]]

⥅ related node [[marxian analysis]]

⥅ related node [[marxian idyll]]

⥅ related node [[marxian idylls]]

⥅ related node [[marxism 101 an interview with hadas thier]]

⥅ related node [[marxism and anarchism]]

⥅ related node [[marxism and ecology]]

⥅ related node [[marxist humanism]]

⥅ related node [[marxist]]

⥅ related node [[marxs ecology]]

⥅ related node [[marxs theory of metabolic rift]]

⥅ related node [[marxs theory of metabolism]]

⥅ related node [[marxs vision of sustainable human development]]

⥅ related node [[mary shelley]]

⥅ related node [[mary wollstonecraft]]

⥅ related node [[mass extinction]]

⥅ related node [[mass extinctions]]

⥅ related node [[mass line]]

⥅ related node [[mass non payment]]

⥅ related node [[mass surveillance]]

⥅ related node [[massachusetts institute of technology]]

⥅ related node [[massively multiplayer open computing]]

⥅ related node [[mastodon annual report 2021]]

⥅ related node [[material conditions]]

⥅ related node [[material efficiency]]

⥅ related node [[mathare social justice centre]]

⥅ related node [[mathematics]]

⥅ related node [[mathew lawrence]]

⥅ related node [[mathew lubari]]

⥅ related node [[matomo]]

⥅ related node [[matrix of convivial technology]]

⥅ related node [[matthew brown]]

⥅ related node [[matthew huber]]

⥅ related node [[max horkheimer]]

⥅ related node [[max liboiron and josh lepawsky discard studies wasting systems and power]]

⥅ related node [[maximilien robespierre]]

⥅ related node [[may 68]]

⥅ related node [[may first movement technology]]

⥅ related node [[mccarthyist]]

⥅ related node [[mckenzie wark general intellects]]

⥅ related node [[mckenzie wark molecular red]]

⥅ related node [[mckenzie wark]]

⥅ related node [[meadow brown]]

⥅ related node [[means of computation]]

⥅ related node [[means of production]]

⥅ related node [[meat consumption]]

⥅ related node [[meat industry]]

⥅ related node [[meat money and messaging]]

⥅ related node [[mechanism design]]

⥅ related node [[media]]

⥅ related node [[medium anxiety]]

⥅ related node [[meidner plan]]

⥅ related node [[memory palaces]]

⥅ related node [[mental wellbeing]]

⥅ related node [[mercado justo]]

⥅ related node [[mermaidjs]]

⥅ related node [[mesh networking]]

⥅ related node [[mesh potato]]

⥅ related node [[metabase]]

⥅ related node [[2024 02 25_18 45 39_screenshot]]

⥅ related node [[metabolic rift]]

⥅ related node [[metacognition]]

⥅ related node [[metacurrency]]

⥅ related node [[metadesign]]

⥅ related node [[metagov]]

⥅ related node [[metamodernism]]

⥅ related node [[metamodernity]]

⥅ related node [[metcalfes law does not apply to commoning]]

⥅ related node [[metcalfes law]]

⥅ related node [[meteorology]]

⥅ related node [[metropolis]]

⥅ related node [[michael albert]]

⥅ related node [[michael gove]]

⥅ related node [[michael kwet]]

⥅ related node [[michael perelman]]

⥅ related node [[michel bauwens]]

⥅ related node [[micro bit]]

⥅ related node [[micro blog]]

⥅ related node [[microbiology]]

⥅ related node [[microblog style social media]]

⥅ related node [[microblogging]]

⥅ related node [[microblurting]]

⥅ related node [[microdose a festive 50 for 2023]]

⥅ related node [[microdose californian capitalism]]

⥅ related node [[microdose revolution from cromwell to castro]]

⥅ related node [[microgeneration]]

⥅ related node [[micropub to git]]

⥅ related node [[microsoft]]

⥅ related node [[microsofts dirty supply chain is holding back its climate ambitions]]

⥅ related node [[microsub]]

⥅ related node [[migrating my nextcloud calendars and contacts]]

⥅ related node [[migrating wordpress sites to digital ocean]]

⥅ related node [[mike cooley]]

⥅ related node [[mike hales]]

⥅ related node [[mikhail bakunin]]

⥅ related node [[militarism]]

⥅ related node [[military industrial complex]]

⥅ related node [[miller columns]]

⥅ related node [[millionaires call on governments worldwide to tax us now]]

⥅ related node [[milton friedman]]

⥅ related node [[mind garden]]

⥅ related node [[mindflayer 1999 animals revenge]]

⥅ related node [[miners strike 1984 the battle for britain]]

⥅ related node [[miners strike]]

⥅ related node [[miniflux issue dial tcp 127 0 0 1 5432 connect connection refused]]

⥅ related node [[miniflux]]

⥅ related node [[minimum viable datafication]]

⥅ related node [[mining]]

⥅ related node [[minions the rise of gru]]

⥅ related node [[ministry future timeline]]

⥅ related node [[minneapolis]]

⥅ related node [[minority report]]

⥅ related node [[mish mash ecologism]]

⥅ related node [[misinformation]]

⥅ related node [[mitterand government]]

⥅ related node [[mixtapes]]

⥅ related node [[miyazaki hayao]]

⥅ related node [[mobilizon]]

⥅ related node [[mode of production]]

⥅ related node [[mode of resistance]]

⥅ related node [[modeless markup]]

⥅ related node [[modephone]]

⥅ related node [[modern paganism]]

⥅ related node [[modern times]]

⥅ related node [[modern unix]]

⥅ related node [[modernism]]

⥅ related node [[modular politics]]

⥅ related node [[molnupiravir]]

⥅ related node [[moloch poem]]

⥅ related node [[monarchy]]

⥅ related node [[monetarism]]

⥅ related node [[money lite commoning]]

⥅ related node [[money]]

⥅ related node [[monopolisation of ai]]

⥅ related node [[monopoly capitalism]]

⥅ related node [[monopoly]]

⥅ related node [[mooc]]

⥅ related node [[more covid variants are inevitable]]

⥅ related node [[morecambe bay]]

⥅ related node [[most likely]]

⥅ related node [[moten and harney]]

⥅ related node [[move fast and break things]]

⥅ related node [[movement and stillness]]

⥅ related node [[movement building]]

⥅ related node [[movement infrastructure]]

⥅ related node [[movement]]

⥅ related node [[moving my wordpress installation to yunohost]]

⥅ related node [[moving towards an ecological leninism]]

⥅ related node [[mozfest]]

⥅ related node [[ms marvel]]

⥅ related node [[mu4e]]

⥅ related node [[muammar gaddafi]]

⥅ related node [[mueller report]]

⥅ related node [[multi stakeholder cooperatives]]

⥅ related node [[multi user org mode]]

⥅ related node [[multimeter]]

⥅ related node [[multiple voices are better than one]]

⥅ related node [[mundane technology]]

⥅ related node [[municipal digital sovereignty]]

⥅ related node [[municipal foss]]

⥅ related node [[municipal online housing]]

⥅ related node [[municipal ownership]]

⥅ related node [[municipal socialism]]

⥅ related node [[municipalist social media]]

⥅ related node [[murmurations]]

⥅ related node [[murray bookchin and the kurdish revolution]]

⥅ related node [[mushrooms]]

⥅ related node [[music listening strategy]]

⥅ related node [[musicforprogramming]]

⥅ related node [[mute compulsion]]

⥅ related node [[mutual aid]]

⥅ related node [[mutual credit societies]]

⥅ related node [[mutual credit]]

⥅ related node [[mutual interest media]]

⥅ related node [[mutualism]]

⥅ related node [[mutualization]]

⥅ related node [[mx linux]]

⥅ related node [[mxgm]]

⥅ related node [[my answers to sophies questions about digital gardens]]

⥅ related node [[my biases]]

⥅ related node [[my blog and wiki process]]

⥅ related node [[my blurts]]

⥅ related node [[my commonplace moodboard]]

⥅ related node [[my devices]]

⥅ related node [[my doom emacs config]]

⥅ related node [[my fish in termux setup]]

⥅ related node [[my garden circles]]

⥅ related node [[my information strategy]]

⥅ related node [[my neighbour totoro]]

⥅ related node [[my orgzly searches]]

⥅ related node [[my personal wiki requirements]]

⥅ related node [[my personal wiki setup]]

⥅ related node [[my publish el configuration]]

⥅ related node [[my social media usage]]

⥅ related node [[my spacemacs user config]]

⥅ related node [[my usage of gnu linux over the years]]

⥅ related node [[myanmar]]

⥅ related node [[mycelium]]

⥅ related node [[mycorrhizal network]]

⥅ related node [[mysociety]]

⥅ related node [[mysql]]

⥅ related node [[myturn]]

⥅ related node [[nadia idle]]

⥅ related node [[nairobi]]

⥅ related node [[naked lunch]]

⥅ related node [[naked]]

⥅ related node [[napster]]

⥅ related node [[narendra modi]]

⥅ related node [[natalia avlona]]

⥅ related node [[nathan sanders]]

⥅ related node [[nathan schneider cooperatives the commons and ownership]]

⥅ related node [[nathan schneider on building democratic governance on the internet]]

⥅ related node [[nathan schneider on cooperatives and digital governance]]

⥅ related node [[nathan schneider pt 2 blockchain governance]]

⥅ related node [[national clarion cycling club]]

⥅ related node [[national food strategy]]

⥅ related node [[national insurance]]

⥅ related node [[nationalisation]]

⥅ related node [[nationality and borders bill]]

⥅ related node [[nationlism]]

⥅ related node [[nato]]

⥅ related node [[natural capital]]

⥅ related node [[nature journaling]]

⥅ related node [[nature matters systems thinking and experts]]

⥅ related node [[nature post truth and platform capitalism with bram buscher]]

⥅ related node [[nature]]

⥅ related node [[nausicaa of the valley of the wind]]

⥅ related node [[negative feedback]]

⥅ related node [[negative income tax]]

⥅ related node [[neils digital garden]]

⥅ related node [[nelson mandela]]

⥅ related node [[neo luddism]]

⥅ related node [[neocolonialism]]

⥅ related node [[neofeudalism the end of capitalism]]

⥅ related node [[neofeudalism]]

⥅ related node [[neoliberal capitalism]]

⥅ related node [[neoliberalism]]

⥅ related node [[nesta]]

⥅ related node [[nested i]]

⥅ related node [[net material product]]

⥅ related node [[net zero is part of a global imperialist climate policy]]

⥅ related node [[net zero policies would reduce the cost of living]]

⥅ related node [[net zero scrutiny group]]

⥅ related node [[net zero]]

⥅ related node [[netblocks]]

⥅ related node [[netlogo]]

⥅ related node [[netocracy]]

⥅ related node [[network address table]]

⥅ related node [[network effects]]

⥅ related node [[network intersubjectives]]

⥅ related node [[network topology]]

⥅ related node [[network weaving]]

⥅ related node [[networked agency]]

⥅ related node [[networked communities]]

⥅ related node [[networked improvement community]]

⥅ related node [[networked learning]]

⥅ related node [[networked protest]]

⥅ related node [[networked thought]]

⥅ related node [[networks of outrage and hope]]

⥅ related node [[networks]]

⥅ related node [[neuromancer]]

⥅ related node [[new books in critical theory]]

⥅ related node [[new connections]]

⥅ related node [[new constellations]]

⥅ related node [[new dark age]]

⥅ related node [[new economics foundation]]

⥅ related node [[new economics podcast should we be going for growth]]

⥅ related node [[new forest]]

⥅ related node [[new frank hester allegations]]

⥅ related node [[new left]]

⥅ related node [[new media]]

⥅ related node [[new municipalism]]

⥅ related node [[new public management]]

⥅ related node [[new towns]]

⥅ related node [[new york passes worlds first electronics right to repair law]]

⥅ related node [[news from nowhere]]

⥅ related node [[newsletter ideas]]

⥅ related node [[newsletter june 2023]]

⥅ related node [[nexta live]]

⥅ related node [[nextcloud issue error creating conflict dialogue]]

⥅ related node [[nextcloud]]

⥅ related node [[nextdoor]]

⥅ related node [[ngi forward]]

⥅ related node [[nhandeflix]]

⥅ related node [[nhs federated data platform]]

⥅ related node [[nhs]]

⥅ related node [[niche construction]]

⥅ related node [[nick couldry]]

⥅ related node [[nick dyer witheford on biocommunism]]

⥅ related node [[nick sellen]]

⥅ related node [[nick srnicek]]

⥅ related node [[nigel farage]]

⥅ related node [[nikita khrushchev]]

⥅ related node [[niklas luhmann]]

⥅ related node [[nitrogen and phosphorus pollution]]

⥅ related node [[nitter]]

⥅ related node [[nixon shock]]

⥅ related node [[no king but ludd ft brian merchant]]

⥅ related node [[no one way works political organisation for the 21st century]]

⥅ related node [[no servers no admins]]

⥅ related node [[no way to open the product]]

⥅ related node [[nobody asked the world if it wanted ai]]

⥅ related node [[node club tarot readings]]

⥅ related node [[node kata]]

⥅ related node [[nodes or patterns]]

⥅ related node [[nois radio]]

⥅ related node [[noise rock]]

⥅ related node [[nominet]]

⥅ related node [[non aligned movement]]

⥅ related node [[non binary]]

⥅ related node [[non destructive disassembly]]

⥅ related node [[non hierarchical note taking]]

⥅ related node [[non reformist reform]]

⥅ related node [[nonlinear]]

⥅ related node [[nonprofits should almost never write their own software]]

⥅ related node [[north america]]

⥅ related node [[north norfolk]]

⥅ related node [[north walney nature reserve]]

⥅ related node [[north west mutual]]

⥅ related node [[northern forest]]

⥅ related node [[nostalgia]]

⥅ related node [[not everyone repairs for the same reasons]]

⥅ related node [[not the end of the world]]

⥅ related node [[note first approach]]

⥅ related node [[notes are conversations across time]]

⥅ related node [[notes big tech wont save us the case for social transformation over coronavirus surveillance]]

⥅ related node [[notes its time to tax big techs data]]

⥅ related node [[notes on can blogs and wikis be merged]]

⥅ related node [[notes on how i use org mode for work and life]]

⥅ related node [[notes on in praise of the flaneur]]

⥅ related node [[notes on johnsons message is very deliberate and very dangerous]]

⥅ related node [[notes on my personal wiki config]]

⥅ related node [[notes on on wikis blogs and note taking]]

⥅ related node [[notes on psychogeography a way to delve into the soul of a city]]

⥅ related node [[notes on the epidemic situation]]

⥅ related node [[novara fm]]

⥅ related node [[novara live assad falls what next for syria]]

⥅ related node [[novara media]]

⥅ related node [[novosibirsk]]

⥅ related node [[nowcasting]]

⥅ related node [[nowtions]]

⥅ related node [[nsfnet]]

⥅ related node [[nuclear energy]]

⥅ related node [[nuclear power]]

⥅ related node [[nuclear waste]]

⥅ related node [[nuka]]

⥅ related node [[numun fund]]

⥅ related node [[nvidia 2 boom 2 bust]]

⥅ related node [[nvidia]]

⥅ related node [[nyc mesh]]

⥅ related node [[o sweet sponatenous]]

⥅ related node [[o sweet spontanenous]]

⥅ related node [[obesity]]

⥅ related node [[object oriented democracy]]

⥅ related node [[objects and relations]]

⥅ related node [[oblique strategy]]

⥅ related node [[obstacles for peer to peer networks]]

⥅ related node [[occupy and stigmergy]]

⥅ related node [[occupy sandy]]

⥅ related node [[occupy wall street a decade later]]

⥅ related node [[occupy wall street]]

⥅ related node [[occupy]]

⥅ related node [[ocean acidification]]

⥅ related node [[ocean]]

⥅ related node [[oceans]]

⥅ related node [[octavia e butler]]

⥅ related node [[october 2019]]

⥅ related node [[october book]]

⥅ related node [[oddly influenced]]

⥅ related node [[offline by default]]

⥅ related node [[ogas]]

⥅ related node [[oil]]

⥅ related node [[olaf stapledon]]

⥅ related node [[olga burmatova]]

⥅ related node [[oliver burkeman]]

⥅ related node [[oliver franklin wallis]]

⥅ related node [[omicron will not fizzle out in the foreseeable future]]

⥅ related node [[omicron will ultimately find just about everybody in terms of exposure]]

⥅ related node [[omicron]]

⥅ related node [[omnibear]]

⥅ related node [[on exactitude in science]]

⥅ related node [[on technology and degrowth]]

⥅ related node [[on the sustainability of free software]]

⥅ related node [[on the waterfront]]

⥅ related node [[one laptop per child]]

⥅ related node [[online content moderation]]

⥅ related node [[online park]]

⥅ related node [[online platforms should return value to the citizen body]]

⥅ related node [[online safety bill]]

⥅ related node [[onshore wind is good]]

⥅ related node [[onshore wind]]

⥅ related node [[ontoshift]]

⥅ related node [[open access]]

⥅ related node [[open blogchains]]

⥅ related node [[open book]]

⥅ related node [[open building institute]]

⥅ related node [[open camera]]

⥅ related node [[open climate areas]]

⥅ related node [[open climate then and now]]

⥅ related node [[open climate]]

⥅ related node [[open cooperativism]]

⥅ related node [[open data commons open database license]]

⥅ related node [[open data]]

⥅ related node [[open educational resources]]

⥅ related node [[open green map]]

⥅ related node [[open hardware]]

⥅ related node [[open library]]

⥅ related node [[open media network]]

⥅ related node [[open referral]]

⥅ related node [[open repair alliance dataset]]

⥅ related node [[open repair alliance]]

⥅ related node [[open repair data]]

⥅ related node [[open source hardware watches]]

⥅ related node [[open source intelligence]]

⥅ related node [[open university]]

⥅ related node [[open value cooperatives]]

⥅ related node [[open worlds]]

⥅ related node [[openengiadina]]

⥅ related node [[opening the vicious circle of risk rating ft ariel bogle]]

⥅ related node [[openwrt]]

⥅ related node [[operational research]]

⥅ related node [[opportunistic compression]]

⥅ related node [[oppression]]

⥅ related node [[optimization]]

⥅ related node [[options for publishing an org roam based digital garden]]

⥅ related node [[oregon]]

⥅ related node [[org agenda]]

⥅ related node [[org auto repeat maybe invalid search bound wrong side of point]]

⥅ related node [[org babel]]

⥅ related node [[org brain]]

⥅ related node [[org capture]]

⥅ related node [[org cite]]

⥅ related node [[org day planner]]

⥅ related node [[org export]]

⥅ related node [[org gtd]]

⥅ related node [[org habit duration to days invalid duration string]]

⥅ related node [[org jira]]

⥅ related node [[org mode and gtd]]

⥅ related node [[org mode and orgzly sync issues]]

⥅ related node [[org mode clock tables]]

⥅ related node [[org mode error invalid function date date]]

⥅ related node [[org mode inline src blocks not publishing]]

⥅ related node [[org node]]

⥅ related node [[org protocol]]

⥅ related node [[org publish]]

⥅ related node [[org ql]]

⥅ related node [[org ref]]

⥅ related node [[org roam and org publish unable to resolve link]]

⥅ related node [[org roam bibtex]]

⥅ related node [[org roam server]]

⥅ related node [[org roam timestamps]]

⥅ related node [[org roam v2]]

⥅ related node [[org roam vs denote]]

⥅ related node [[2020 05 02_22 08 47_screenshot]]

⥅ related node [[org timeblock]]

⥅ related node [[orga]]

⥅ related node [[organisational ecology]]

⥅ related node [[organisational tech digital policies]]

⥅ related node [[organising for revolution with rodrigo nunes]]

⥅ related node [[organising]]

⥅ related node [[organizational platform of the libertarian communists]]

⥅ related node [[organizing toolbox getting started]]

⥅ related node [[orgrr]]

⥅ related node [[orgzly revived]]

⥅ related node [[origins of the universe]]

⥅ related node [[orthographic media]]

⥅ related node [[osi model]]

⥅ related node [[osint]]

⥅ related node [[osm landuse landcover]]

⥅ related node [[ostrom contracts]]

⥅ related node [[otto neurath]]

⥅ related node [[oubliette]]

⥅ related node [[our changing climate]]

⥅ related node [[our feelings are not just biological but also social and cultural and therefore historical]]

⥅ related node [[our synthetic environment]]

⥅ related node [[ours to hack and own]]

⥅ related node [[ours to hack and to own]]

⥅ related node [[ours to master and to own]]

⥅ related node [[outlandish]]

⥅ related node [[outlines]]

⥅ related node [[outlining vs bullet pointing in org mode]]

⥅ related node [[outlining vs writing]]

⥅ related node [[outlook good]]

⥅ related node [[outrage]]

⥅ related node [[overconsumption]]

⥅ related node [[overshoot of planetary boundaries]]

⥅ related node [[own your data]]

⥅ related node [[2020 04 03_18 53 51_ikluoez]]

⥅ related node [[2020 04 03_18 56 15_3wbfj1q]]

⥅ related node [[ownership]]

⥅ related node [[ozone hole]]

⥅ related node [[p2p accounting for planetary survival]]

⥅ related node [[p2p accounting]]

⥅ related node [[p2p foundation wiki]]

⥅ related node [[p2p]]

⥅ related node [[pacifism]]

⥅ related node [[pacman lantern]]

⥅ related node [[pagefind]]

⥅ related node [[pakistan floods and cop 27 with asad rehman]]

⥅ related node [[pakistan]]

⥅ related node [[palaces for the people the future of public libraries]]

⥅ related node [[palaces for the people]]

⥅ related node [[palantir]]

⥅ related node [[palestine speaks for everyone]]

⥅ related node [[palestine]]

⥅ related node [[palestinian authority]]

⥅ related node [[palestinian liberation organization]]

⥅ related node [[palo alto a history of california capitalism and the world]]

⥅ related node [[palo alto]]

⥅ related node [[panarchy]]

⥅ related node [[panda]]

⥅ related node [[pans labyrinth]]

⥅ related node [[pantheism]]

⥅ related node [[parable of the sower]]

⥅ related node [[parallel polis]]

⥅ related node [[parallel writing]]

⥅ related node [[parenting]]

⥅ related node [[paris agreement]]

⥅ related node [[paris commune]]

⥅ related node [[paris marx]]

⥅ related node [[parkrun]]

⥅ related node [[parliament of things]]

⥅ related node [[part pairing]]

⥅ related node [[participate in social media on your own terms]]

⥅ related node [[participation]]

⥅ related node [[participatory budgeting]]

⥅ related node [[participatory culture]]

⥅ related node [[participatory democracy]]

⥅ related node [[participatory design]]

⥅ related node [[participatory economics]]

⥅ related node [[participatory governance]]

⥅ related node [[participatory infrastructure]]

⥅ related node [[participatory modelling]]

⥅ related node [[participatory planning]]

⥅ related node [[participatory social network]]

⥅ related node [[partition of india]]

⥅ related node [[parts pairing]]

⥅ related node [[partygate]]

⥅ related node [[pass]]

⥅ related node [[passive repetition]]

⥅ related node [[passivhaus]]

⥅ related node [[passkeys]]

⥅ related node [[passports were once a temporary measure]]

⥅ related node [[pat testing]]

⥅ related node [[patent waivers]]

⥅ related node [[paths]]

⥅ related node [[pathways that ive done on kinnu]]

⥅ related node [[patio]]

⥅ related node [[patrice lumumba]]

⥅ related node [[patrick]]

⥅ related node [[patriotic millionaires]]

⥅ related node [[pattern recognition]]

⥅ related node [[patternlanguage commoning wiki]]

⥅ related node [[patterns of connection]]

⥅ related node [[patterns of enterprise application architecture]]

⥅ related node [[patterns vs principles]]

⥅ related node [[paul mason]]

⥅ related node [[paul pangaro]]

⥅ related node [[paulo freire]]

⥅ related node [[paxlovid]]

⥅ related node [[payback]]

⥅ related node [[peak oil]]

⥅ related node [[peanut butter cookies]]

⥅ related node [[peat bogs]]

⥅ related node [[pedosphere]]

⥅ related node [[peer discovery]]

⥅ related node [[peer governance]]

⥅ related node [[peer organization]]

⥅ related node [[peer production license]]

⥅ related node [[peer production]]

⥅ related node [[peer to peer networks]]

⥅ related node [[peer to peer]]

⥅ related node [[people farming]]

⥅ related node [[people like wind power]]

⥅ related node [[peoples agreement of cochabamba]]

⥅ related node [[peoples assembly]]

⥅ related node [[peoples computer company]]

⥅ related node [[peoples history museum]]

⥅ related node [[perceptions of degrowth in the european parliament]]

⥅ related node [[percy shelley]]

⥅ related node [[perdido street station]]

⥅ related node [[peregrin falcons]]

⥅ related node [[periodization]]

⥅ related node [[periodo especial]]

⥅ related node [[permacomputing]]

⥅ related node [[permalinks and forgetting]]

⥅ related node [[permanent notes]]

⥅ related node [[personal computing]]

⥅ related node [[personal data store]]

⥅ related node [[personal learning environment]]

⥅ related node [[personal sites that i like]]

⥅ related node [[personal sites]]

⥅ related node [[personal textbooks]]

⥅ related node [[personal website]]

⥅ related node [[personal wiki page size]]

⥅ related node [[personal wiki software ive considered or have seen recommended]]

⥅ related node [[personal wiki tooling]]

⥅ related node [[personal wikis]]

⥅ related node [[pesticides]]

⥅ related node [[peter frase]]

⥅ related node [[peter kropotkin]]

⥅ related node [[petnames]]

⥅ related node [[pharo]]

⥅ related node [[phase transition]]

⥅ related node [[philosophical pragmatism]]

⥅ related node [[philosophize this]]

⥅ related node [[phone story]]

⥅ related node [[birkrigg common view over bay inlet]]

⥅ related node [[birkrigg common view to lake district]]

⥅ related node [[black combe from walney island]]

⥅ related node [[clouds at the bay]]

⥅ related node [[common cordgrass at estuary]]

⥅ related node [[fells from waterhead]]

⥅ related node [[gorse on birkrigg]]

⥅ related node [[harebell on birkrigg]]

⥅ related node [[heron and little egret]]

⥅ related node [[heysham promenade]]

⥅ related node [[behind pike o blisco 2]]

⥅ related node [[behind pike o blisco]]

⥅ related node [[grasmere from loughrigg]]

⥅ related node [[next to coniston]]

⥅ related node [[windermere from loughrigg]]

⥅ related node [[wrynose pass]]

⥅ related node [[lakes from hoad]]

⥅ related node [[middleton turbines]]

⥅ related node [[north walney nature reserve black combe]]

⥅ related node [[north walney nature reserve pool]]

⥅ related node [[purple small reed brick kiln road]]

⥅ related node [[salt marsh]]

⥅ related node [[sea aster at estuary]]

⥅ related node [[sowthistle at estuary]]

⥅ related node [[sunderland point]]

⥅ related node [[sunset in lancaster]]

⥅ related node [[the cragg towards bowland]]

⥅ related node [[the cragg turbines]]

⥅ related node [[the moon]]

⥅ related node [[walney coast]]

⥅ related node [[williamson park towards lake district]]

⥅ related node [[photosensitive microphone]]

⥅ related node [[phpunit]]

⥅ related node [[pinecil]]

⥅ related node [[pl ntnet]]

⥅ related node [[places i like]]

⥅ related node [[placing my daily logs in a journal subfolder]]

⥅ related node [[plain text accounting]]

⥅ related node [[plane of immanence]]

⥅ related node [[planet mu]]

⥅ related node [[planet on fire a manifesto for the age of environmental breakdown]]

⥅ related node [[planetary boundaries]]

⥅ related node [[planetary boundary]]

⥅ related node [[planetary scale computation]]

⥅ related node [[planetary sovereign]]

⥅ related node [[planetary stability]]

⥅ related node [[planetary work machine]]

⥅ related node [[planned economy]]

⥅ related node [[planned obsolescence]]

⥅ related node [[planning permission]]

⥅ related node [[planning]]

⥅ related node [[plant protein]]

⥅ related node [[plants]]

⥅ related node [[plantuml for weeknote diagrams]]

⥅ related node [[plantuml]]

⥅ related node [[platform cooperatives]]

⥅ related node [[platform cooperativism]]

⥅ related node [[platform coops]]

⥅ related node [[platform economy]]

⥅ related node [[platform government]]

⥅ related node [[platform socialism and web3]]

⥅ related node [[platform socialism]]

⥅ related node [[platform sovereignty]]

⥅ related node [[platform]]

⥅ related node [[platforming equality policy challenges for the digital economy]]

⥅ related node [[platforms for public good w mathew lawrence thomas hanna]]

⥅ related node [[playing music on the web]]

⥅ related node [[plessey occupation]]

⥅ related node [[plotting the growth of my digital garden]]

⥅ related node [[pluralism]]

⥅ related node [[podcast series]]

⥅ related node [[podcasting]]

⥅ related node [[polarcell]]

⥅ related node [[police brutality]]

⥅ related node [[police licence]]

⥅ related node [[policing bill]]

⥅ related node [[political action]]

⥅ related node [[political agency]]

⥅ related node [[political climate education with momentum]]

⥅ related node [[political club]]

⥅ related node [[political commitment]]

⥅ related node [[political donations]]

⥅ related node [[political economy of ai]]

⥅ related node [[political economy of free software]]

⥅ related node [[political economy of network topologies]]

⥅ related node [[political economy]]

⥅ related node [[political education]]

⥅ related node [[political history]]

⥅ related node [[political organisation]]

⥅ related node [[political philosophy]]

⥅ related node [[political theory and film]]

⥅ related node [[political theory]]

⥅ related node [[politics and comedy]]

⥅ related node [[politics and the north west of england]]

⥅ related node [[politics of belonging]]

⥅ related node [[politics of technology]]

⥅ related node [[politics weekly westminster the first tv debate]]

⥅ related node [[poll tax]]

⥅ related node [[polluter elite]]

⥅ related node [[polycentric]]

⥅ related node [[polycentrism]]

⥅ related node [[polycrisis]]

⥅ related node [[pomodoro for the revolution]]

⥅ related node [[pomodoro praxis]]

⥅ related node [[ponyo]]

⥅ related node [[popular assembly]]

⥅ related node [[populism anarchism and the movement of the squares]]

⥅ related node [[populism]]

⥅ related node [[positive feedback loop]]

⥅ related node [[posse vs pesos]]

⥅ related node [[post capitalism w alnoor ladha]]

⥅ related node [[post capitalism]]

⥅ related node [[post capitalist markets]]

⥅ related node [[post covid]]

⥅ related node [[post fordism]]

⥅ related node [[post growth life after capitalism]]

⥅ related node [[post growth living]]

⥅ related node [[post growth vs degrowth]]

⥅ related node [[post growth]]

⥅ related node [[post open source]]

⥅ related node [[post scarcity anarchism]]

⥅ related node [[post structuralism]]

⥅ related node [[postmodernism or the cultural logic of late capitalism]]

⥅ related node [[postmodernism]]

⥅ related node [[potestas and potentia]]

⥅ related node [[pots and pans revolution]]

⥅ related node [[power failure]]

⥅ related node [[ppm]]

⥅ related node [[prague spring]]

⥅ related node [[praxis for the hacker class]]

⥅ related node [[precautionary principle]]

⥅ related node [[precision fermentation]]

⥅ related node [[predictive policing]]

⥅ related node [[predictive value]]

⥅ related node [[prefer knowledge commoning over knowledge work]]

⥅ related node [[prefer the subjective over the objective]]

⥅ related node [[prefiguration]]

⥅ related node [[prefigurative]]

⥅ related node [[preguntando caminamos]]

⥅ related node [[prejudice]]

⥅ related node [[preparing for org roam v2]]

⥅ related node [[preston cooperative development network]]

⥅ related node [[preston]]

⥅ related node [[price discovery]]

⥅ related node [[price]]

⥅ related node [[primary literature]]

⥅ related node [[primitive accumulation]]

⥅ related node [[princess mononoke]]

⥅ related node [[principles ethical tech]]

⥅ related node [[principles for ethical technology]]

⥅ related node [[principles of stacktivism]]

⥅ related node [[prioritization algorithms]]

⥅ related node [[prison abolition]]

⥅ related node [[prison]]

⥅ related node [[prisoners dilemma]]

⥅ related node [[privacy is not the problem with the apple google contact tracing toolkit]]

⥅ related node [[private property]]

⥅ related node [[privatisation of the internet]]

⥅ related node [[privatisation]]

⥅ related node [[privitisation]]

⥅ related node [[pro repair policies]]

⥅ related node [[problem error running timer]]

⥅ related node [[problem logging in to yunohost after upgrade]]

⥅ related node [[problem no such file or directory tramp archive]]

⥅ related node [[problem org preserve local variables error when refiling]]

⥅ related node [[problem package phpcbf is unavailable]]

⥅ related node [[problem relative paths in org publish]]

⥅ related node [[problem with kobo clara hd battery]]

⥅ related node [[problem with koreader generator error]]

⥅ related node [[problem with org roams file level graphing]]

⥅ related node [[problems with an old mouse]]

⥅ related node [[problems with ecosocialism]]

⥅ related node [[problems with org publish cache]]

⥅ related node [[problems with sd card on android lineageos]]

⥅ related node [[producer cooperatives]]

⥅ related node [[producing not just consuming]]

⥅ related node [[product platforms]]

⥅ related node [[production is socialised profit is privatised]]

⥅ related node [[production]]

⥅ related node [[productivity]]

⥅ related node [[proem]]

⥅ related node [[professional managerial class]]

⥅ related node [[programmable notes]]

⥅ related node [[progressive summarisation]]

⥅ related node [[project ideas]]

⥅ related node [[project insight]]

⥅ related node [[project management]]

⥅ related node [[project wbs]]

⥅ related node [[projects and activities]]

⥅ related node [[prometheanism]]

⥅ related node [[promiscuous care]]

⥅ related node [[proof of stake]]

⥅ related node [[proof of work]]

⥅ related node [[property]]

⥅ related node [[proprietary empires built on free software]]

⥅ related node [[prosocial world]]

⥅ related node [[prosocial]]

⥅ related node [[prosperity without growth]]

⥅ related node [[proteins]]

⥅ related node [[protest songs]]

⥅ related node [[protest]]

⥅ related node [[protocol cooperatives]]

⥅ related node [[protocol cooperativism]]

⥅ related node [[protocols for commoning]]

⥅ related node [[protonmail android app takes a long time to load messages]]

⥅ related node [[protonmail]]

⥅ related node [[provision a wordpress server at digital ocean]]

⥅ related node [[provisioning through commons]]

⥅ related node [[provisioning]]

⥅ related node [[pseudorationality]]

⥅ related node [[psychogeography]]

⥅ related node [[public banking system]]

⥅ related node [[public collective partnerships]]

⥅ related node [[public commons circuits of finance]]

⥅ related node [[public commons partnerships]]

⥅ related node [[public digital cooperative]]

⥅ related node [[public domain]]

⥅ related node [[public drafts]]

⥅ related node [[public education]]

⥅ related node [[public good]]

⥅ related node [[public interest technology and its origins]]

⥅ related node [[public interest technology]]

⥅ related node [[public land ownership]]

⥅ related node [[public libraries]]

⥅ related node [[public library of science]]

⥅ related node [[public money public code]]

⥅ related node [[public order act]]

⥅ related node [[public ownership 2 0]]

⥅ related node [[public ownership]]

⥅ related node [[public platform accelerator]]

⥅ related node [[public platforms]]

⥅ related node [[public private partnerships]]

⥅ related node [[public procurement]]

⥅ related node [[public sector free software]]

⥅ related node [[public services]]

⥅ related node [[public space]]

⥅ related node [[public transport]]

⥅ related node [[publicatorg]]

⥅ related node [[publishing org roam via gitlab ci]]

⥅ related node [[publishing vs tinkering]]

⥅ related node [[publishing your org roam wiki map to the web overview]]

⥅ related node [[publishing your org roam wiki map to the web technical details]]

⥅ related node [[pueblo revolt]]

⥅ related node [[pulling out useful information from gravity forms entry meta]]

⥅ related node [[pulling stats out of org roam]]

⥅ related node [[2020 03 15_10 50 35_ylxbc2o]]

⥅ related node [[2020 03 15_10 52 14_3tfh9i4]]

⥅ related node [[2020 03 15_10 59 53_e2jvr0c]]

⥅ related node [[purging unused css from my org publish]]

⥅ related node [[putin]]

⥅ related node [[putting the space in cyberspace]]

⥅ related node [[putting together the eight electro synth]]

⥅ related node [[quadratic voting]]

⥅ related node [[qualitative and quantitative modelling in system dynamics]]

⥅ related node [[qualitative system dynamics model]]

⥅ related node [[qualitative system dynamics modeling]]

⥅ related node [[qualititative system dynamics model]]

⥅ related node [[quantitative system dynamics model]]

⥅ related node [[quasar framework]]

⥅ related node [[quebec student protests]]

⥅ related node [[querying org roam]]

⥅ related node [[question]]

⥅ related node [[questions about my digital garden]]

⥅ related node [[quora]]

⥅ related node [[r scholar]]

⥅ related node [[racial inequality]]

⥅ related node [[radical abundance]]

⥅ related node [[radical nostalgia]]

⥅ related node [[radical open access collective]]

⥅ related node [[radical technologies]]

⥅ related node [[radical technology must be accompanied by radical politics]]

⥅ related node [[ralph nader]]

⥅ related node [[raman pratasevich]]

⥅ related node [[ransomware]]

⥅ related node [[raqqa]]

⥅ related node [[rationalism]]

⥅ related node [[ravi agarwal]]

⥅ related node [[anarchist cybernetics raw highlights]]

⥅ related node [[free fair and alive highlights]]

⥅ related node [[ray ison]]

⥅ related node [[ray tomlinson]]

⥅ related node [[re ification]]

⥅ related node [[rea accounting]]

⥅ related node [[rea]]

⥅ related node [[reaction]]

⥅ related node [[read feeder]]

⥅ related node [[2020 05 03_13 40 11_y2gd4mv]]

⥅ related node [[reading tweets without being on twitter]]

⥅ related node [[real subsumption]]

⥅ related node [[reality is identical with divinity]]

⥅ related node [[reasons to be cheerful]]

⥅ related node [[reasons to repair]]

⥅ related node [[rebecca solnit]]

⥅ related node [[rebel cities]]

⥅ related node [[rebellion]]

⥅ related node [[receiving webmentions on my digital garden]]

⥅ related node [[receiving webmentions via nginx]]

⥅ related node [[recent activity in neils digital garden]]

⥅ related node [[recent noodlings]]

⥅ related node [[recession]]

⥅ related node [[recidivism]]

⥅ related node [[recipes for the cookshops of the future]]

⥅ related node [[reclaim roundup august 2023]]

⥅ related node [[reclaim roundup july 2023]]

⥅ related node [[reclaim the stacks october 2023 roundup]]

⥅ related node [[reclaim the stacks reflections may 2024]]

⥅ related node [[reclaim the stacks]]

⥅ related node [[reclaim the streets]]

⥅ related node [[reclaim]]

⥅ related node [[reclaiming the stacks august 2023 roundup]]

⥅ related node [[reclaiming the stacks reading]]

⥅ related node [[reclaiming the stacks september 2023 roundup]]

⥅ related node [[reclaiming the stacks]]

⥅ related node [[reclaiming time with oliver burkeman in conversation]]

⥅ related node [[recoleta]]

⥅ related node [[record the journey as well as the destination]]

⥅ related node [[recycle for cumbria]]

⥅ related node [[recycling]]

⥅ related node [[red army faction]]

⥅ related node [[red brigades]]

⥅ related node [[red enlightenment on socialism science and spirituality]]

⥅ related node [[red enlightenment podcast]]

⥅ related node [[red enlightenment]]

⥅ related node [[red green revolution]]

⥅ related node [[red hook brooklyn]]

⥅ related node [[red kite]]

⥅ related node [[red mars]]

⥅ related node [[red menace climate leviathan a political theory of our planetary future]]

⥅ related node [[red menace]]

⥅ related node [[red plenty]]

⥅ related node [[red rosa]]

⥅ related node [[red stack]]

⥅ related node [[red]]

⥅ related node [[rede mocambos]]

⥅ related node [[redemption]]

⥅ related node [[redistribution of informational wealth]]

⥅ related node [[reduction of the working week]]

⥅ related node [[reductionism]]

⥅ related node [[reductionist view of history]]

⥅ related node [[reductionist]]

⥅ related node [[reference notes]]

⥅ related node [[reform uk]]

⥅ related node [[reframing and simplifying the idea of how to keep a zettelkasten]]

⥅ related node [[regenerative economy]]

⥅ related node [[regenerative farming]]

⥅ related node [[regenesis]]

⥅ related node [[regime of accumulation]]

⥅ related node [[regime]]

⥅ related node [[regulations]]

⥅ related node [[regulatory activism]]

⥅ related node [[reification]]

⥅ related node [[reincarnation]]

⥅ related node [[reinventing how we use computers]]

⥅ related node [[relational ontology]]

⥅ related node [[relationality]]

⥅ related node [[relations of production]]

⥅ related node [[relationship between assemblage thinking and actor network theory]]

⥅ related node [[relentless growth is the ultimate logic of capitalism]]

⥅ related node [[religion is the opium of the people]]

⥅ related node [[religion]]

⥅ related node [[rely on distributed structures]]

⥅ related node [[rely on heterarchy]]

⥅ related node [[removing html extension from urls with apache]]

⥅ related node [[renata avila]]

⥅ related node [[rene descartes]]

⥅ related node [[renewable energy cannot meet current demand]]

⥅ related node [[renewable energy]]

⥅ related node [[rent]]

⥅ related node [[repair acts]]

⥅ related node [[repair and degrowth]]

⥅ related node [[repair and jobs]]

⥅ related node [[repair and reuse in the ipcc sixth assessment report]]

⥅ related node [[repair bonus voucher scheme]]

⥅ related node [[repair cafe]]

⥅ related node [[repair index]]

⥅ related node [[repair information]]

⥅ related node [[repair is anti capitalist praxis]]

⥅ related node [[repair manuals]]

⥅ related node [[repair prices]]

⥅ related node [[repair reconnects us to the materiality of objects]]

⥅ related node [[repair undercuts commodity fetishism]]

⥅ related node [[repair]]

⥅ related node [[repairability index]]

⥅ related node [[repairability scores]]

⥅ related node [[repairability standard]]

⥅ related node [[repairability]]

⥅ related node [[repairing a canon mg2550s]]

⥅ related node [[repairing a canon pixma g3510]]

⥅ related node [[repairing a canon pixma ts3150]]

⥅ related node [[repairing a cat mate c500 automatic pet feeder]]

⥅ related node [[repairing a dell latitude e7450]]

⥅ related node [[repairing an acer aspire one 753 with no power]]

⥅ related node [[repairing canon pixma mx925]]

⥅ related node [[repairing our way out of commodity fetishism]]

⥅ related node [[repertoires of action]]

⥅ related node [[repertoires of contention]]

⥅ related node [[replacing google fonts remote server usage with a locally served font]]

⥅ related node [[replacing google fonts with bunny fonts]]

⥅ related node [[replika]]

⥅ related node [[reply hazy try again]]

⥅ related node [[reply to email questions about my digital garden]]

⥅ related node [[reporting in iran could get you jailed this outlet is doing it anyway]]

⥅ related node [[repression]]

⥅ related node [[repressive state]]

⥅ related node [[requisite variety]]

⥅ related node [[resist regulate recode]]

⥅ related node [[resist the feudal internet]]

⥅ related node [[resist]]

⥅ related node [[resistance movements must also build alternatives]]

⥅ related node [[resistance to amazons headquarters in cape town]]

⥅ related node [[resistance to free basics in india]]

⥅ related node [[resistance]]

⥅ related node [[resolution foundation]]

⥅ related node [[resource allocation]]

⥅ related node [[resource mobilisation theory]]

⥅ related node [[resources events agents]]

⥅ related node [[restart radio our 2021 summer reading list]]

⥅ related node [[restart radio]]

⥅ related node [[restart]]

⥅ related node [[restarters tooting]]

⥅ related node [[restoration ecology]]

⥅ related node [[restoring the commons]]

⥅ related node [[restricted boot]]

⥅ related node [[rethinking infrastructure the case for social investment]]

⥅ related node [[reuse]]

⥅ related node [[revenue strike]]

⥅ related node [[review article]]

⥅ related node [[review future histories]]

⥅ related node [[review hello world how to be human in the age of the machine]]

⥅ related node [[review of half earth socialism]]

⥅ related node [[review peoples republic of walmart]]

⥅ related node [[revisionism]]

⥅ related node [[revisiting the calculation debate a call for a multiscale approach]]

⥅ related node [[revolution in rojava]]

⥅ related node [[revolution in the 21st century chris harman]]

⥅ related node [[revolution or ruin]]

⥅ related node [[revolutionary communist league of britain]]

⥅ related node [[revolutionary left radio the french revolution]]

⥅ related node [[revolutionary left radio]]

⥅ related node [[revolutionary leftism with breht oshea]]

⥅ related node [[revolutionary letters]]

⥅ related node [[revolutionary party]]

⥅ related node [[revolutionary socialism]]

⥅ related node [[revolutionary strategies on a heated earth]]

⥅ related node [[revolutionary strategy]]

⥅ related node [[revolutionary subject]]

⥅ related node [[revolutionary transition]]

⥅ related node [[revolutionary violence]]

⥅ related node [[revolutionary waves]]

⥅ related node [[revolutionary]]

⥅ related node [[reweirding the web]]

⥅ related node [[rewilding]]

⥅ related node [[rhino camp refugee settlement]]

⥅ related node [[rhizomatica]]

⥅ related node [[richard barbrook]]

⥅ related node [[richard brautigan]]

⥅ related node [[richard seymour]]

⥅ related node [[right libertarian]]

⥅ related node [[right to buy]]

⥅ related node [[right to protest]]

⥅ related node [[right to repair in europe]]

⥅ related node [[right to repair in the uk]]

⥅ related node [[right to repair in the us]]

⥅ related node [[right to repair legislation]]

⥅ related node [[right to repair]]

⥅ related node [[right to roam]]

⥅ related node [[rights of electronics workers]]

⥅ related node [[ripple energy]]

⥅ related node [[risc v]]

⥅ related node [[rise of the robots]]

⥅ related node [[rise up]]

⥅ related node [[rishi sunak]]

⥅ related node [[rishi sunaks spring statement 2022 is useless]]

⥅ related node [[ritualize togetherness]]

⥅ related node [[road of life]]

⥅ related node [[robert biel]]

⥅ related node [[robert owen]]

⥅ related node [[robin hahnel on parecon part 1]]

⥅ related node [[robin hahnel]]

⥅ related node [[rodrigo nunes]]

⥅ related node [[roger hallam]]

⥅ related node [[rokhsana fiaz]]

⥅ related node [[rolling jubilee]]

⥅ related node [[rosa luxemburg]]

⥅ related node [[rosca]]

⥅ related node [[ross ashby]]

⥅ related node [[royal festival hall]]

⥅ related node [[rss bridge]]

⥅ related node [[2020 03 15_11 54 45_n2fyxl8]]

⥅ related node [[2020 03 15_11 55 54_w6qm8oo]]

⥅ related node [[2020 03 15_12 01 58_vvzvnic]]

⥅ related node [[2020 03 15_12 05 00_p2xwg7u]]

⥅ related node [[2020 03 15_12 11 47_mdouzps]]

⥅ related node [[2020 03 15_12 14 05_fjmf3iq]]

⥅ related node [[2020 03 15_14 06 35_oxh6s2g]]

⥅ related node [[rsync net]]

⥅ related node [[rubiks cube]]

⥅ related node [[rule based algorithms]]

⥅ related node [[running org roam and orgrr side by side]]

⥅ related node [[russia]]

⥅ related node [[rwanda bill]]

⥅ related node [[sabotage]]

⥅ related node [[sacred economics]]

⥅ related node [[sacred stacks the art of cyborg community]]

⥅ related node [[sage]]

⥅ related node [[sajid javid]]

⥅ related node [[salford]]

⥅ related node [[salvadore allende]]

⥅ related node [[salvatore engel di mauro]]

⥅ related node [[sam moore of the radical open access collective]]

⥅ related node [[samir amin]]

⥅ related node [[samsung and right to repair]]

⥅ related node [[samsung galaxy s5]]

⥅ related node [[samsung is working on a galaxy self repair program with ifixit]]

⥅ related node [[samsung]]

⥅ related node [[sand battery]]

⥅ related node [[sand martin]]

⥅ related node [[sarafu credit]]

⥅ related node [[scarcity]]

⥅ related node [[schellings model of segregation]]

⥅ related node [[schizoanalysis]]

⥅ related node [[school]]

⥅ related node [[science and spirituality]]

⥅ related node [[science and technology studies]]

⥅ related node [[science commons]]

⥅ related node [[science technology and society]]

⥅ related node [[scientific management]]

⥅ related node [[scientific socialism]]

⥅ related node [[scientific utopianism]]

⥅ related node [[scientifiction]]

⥅ related node [[scope 3 emissions]]

⥅ related node [[scorched earth beyond the digital age to a post capitalist world]]

⥅ related node [[scotland]]

⥅ related node [[screen capitalism]]

⥅ related node [[screenshot_2020 04 03 19 00 17]]

⥅ related node [[seagreen wind farm]]

⥅ related node [[seal]]

⥅ related node [[search engines]]

⥅ related node [[search on mastodon]]

⥅ related node [[second international]]

⥅ related node [[second order cybernetics]]

⥅ related node [[secondary literature]]

⥅ related node [[secular spirituality]]

⥅ related node [[secure boot]]

⥅ related node [[secure messaging]]

⥅ related node [[securedrop]]

⥅ related node [[security]]

⥅ related node [[seeding the wild]]

⥅ related node [[seedling]]

⥅ related node [[seek sense share]]

⥅ related node [[seize the means of computation]]

⥅ related node [[selectively publishing to the stream]]

⥅ related node [[self governance is a mode of resistance]]

⥅ related node [[self governance]]

⥅ related node [[self hosting conundrum]]

⥅ related node [[self hosting platforms]]

⥅ related node [[self hosting]]

⥅ related node [[self organisation in nature]]

⥅ related node [[self organisation]]

⥅ related node [[self organising systems should be the terrain of the left]]

⥅ related node [[self ownership]]

⥅ related node [[self repair]]

⥅ related node [[sellafield europe s most toxic nuclear site]]

⥅ related node [[sellafield]]

⥅ related node [[semantic triples]]

⥅ related node [[semantic web]]

⥅ related node [[semantics]]

⥅ related node [[semi permeable membrane]]

⥅ related node [[semiotics]]

⥅ related node [[2022 03 04_18 09 34_screenshot]]

⥅ related node [[2022 03 04_18 10 09_screenshot]]

⥅ related node [[sensemaking]]

⥅ related node [[sensitive dependence on initial conditions]]

⥅ related node [[sentient city]]

⥅ related node [[separation of article concerns]]

⥅ related node [[serialisation]]

⥅ related node [[server infrastructure for global rebellion]]

⥅ related node [[servers should be background infrastructure]]

⥅ related node [[servers should provide a supporting role not a central role]]

⥅ related node [[seto kaiba is my role model]]

⥅ related node [[setting up a literate publish el with org babel]]

⥅ related node [[setting up a new box]]

⥅ related node [[setting up a simple email forwarder]]

⥅ related node [[setting up a spacemacs literate config file]]

⥅ related node [[setting up apache sites on a new port]]

⥅ related node [[setting up calibre web and koreader via yunohost and nextcloud]]

⥅ related node [[setting up commonplace locally on tablet]]

⥅ related node [[setting up doom emacs in termux on android]]

⥅ related node [[setting up elfeed]]

⥅ related node [[setting up mysql]]

⥅ related node [[setting up yunohost]]

⥅ related node [[sewers]]

⥅ related node [[sexual revolution]]

⥅ related node [[shackles of digital freedom]]

⥅ related node [[shannon information]]

⥅ related node [[shared solar]]

⥅ related node [[sharing information systems is praxis for the hacker class]]

⥅ related node [[sharing of resources]]

⥅ related node [[shaun chamberlin on david flemings vision of post capitalist life]]

⥅ related node [[shaun chamberlin]]

⥅ related node [[she never cries]]

⥅ related node [[shells]]

⥅ related node [[shenzhen ideology]]

⥅ related node [[shevek]]

⥅ related node [[shift phone]]

⥅ related node [[shirebrook]]

⥅ related node [[shobita parthasarathy]]

⥅ related node [[shock doctrine as a service]]

⥅ related node [[shock doctrine]]

⥅ related node [[shock]]

⥅ related node [[shop stewards movement]]

⥅ related node [[shortage economy]]

⥅ related node [[shortages]]

⥅ related node [[should i send webmentions from my digital garden]]

⥅ related node [[should the uk stop arming israel]]

⥅ related node [[shower nri]]

⥅ related node [[shower thought]]

⥅ related node [[sicp]]

⥅ related node [[sidewalk labs]]

⥅ related node [[sidewalk toronto]]

⥅ related node [[sift]]

⥅ related node [[signalise]]

⥅ related node [[signs point to yes]]

⥅ related node [[silent spring]]

⥅ related node [[silicon empires the fight for the future of ai]]

⥅ related node [[silicon valley imperialism]]

⥅ related node [[silicon valley]]

⥅ related node [[silke helfrich david bollier what is the commons]]

⥅ related node [[silos]]

⥅ related node [[silvia federici]]

⥅ related node [[simple critical infrastructure maps]]

⥅ related node [[simulacra]]

⥅ related node [[sino soviet split]]

⥅ related node [[site deaths]]

⥅ related node [[site of struggle]]

⥅ related node [[sites that i like]]

⥅ related node [[situationism]]

⥅ related node [[sixth extinction]]

⥅ related node [[sketches]]

⥅ related node [[skg]]

⥅ related node [[skills]]

⥅ related node [[skipping errors during org publish]]

⥅ related node [[slashlinks]]

⥅ related node [[slavery]]

⥅ related node [[slime mould]]

⥅ related node [[slow computing]]

⥅ related node [[slow writing]]

⥅ related node [[small is beautiful]]

⥅ related node [[small tech]]

⥅ related node [[small web]]

⥅ related node [[smalltalk and commonplace books]]

⥅ related node [[smalltalk]]

⥅ related node [[smart cities]]

⥅ related node [[smart contract]]

⥅ related node [[smart contracts]]

⥅ related node [[smartphone]]

⥅ related node [[smartphones]]

⥅ related node [[smashing capitalism]]

⥅ related node [[smoke tests]]

⥅ related node [[snap]]

⥅ related node [[snikket]]

⥅ related node [[snowflake method]]

⥅ related node [[sobornost]]

⥅ related node [[social and environmental issues are interconnected and inseparable]]

⥅ related node [[social care]]

⥅ related node [[social change has never come without violence]]

⥅ related node [[social change will never come without violence]]

⥅ related node [[social change]]

⥅ related node [[social contract]]

⥅ related node [[social coop spring 2022 strategy session]]

⥅ related node [[social coop tech wg meeting 2022 05 20]]

⥅ related node [[social data]]

⥅ related node [[social democracy]]

⥅ related node [[social distance]]

⥅ related node [[social distancing]]

⥅ related node [[social ecology]]

⥅ related node [[social equity]]

⥅ related node [[social housing]]

⥅ related node [[social industry]]

⥅ related node [[social inequity is bad]]

⥅ related node [[social inequity]]

⥅ related node [[social infrastructure]]

⥅ related node [[social insertion]]

⥅ related node [[social insurance is a bulwark against insecurity]]

⥅ related node [[social justice]]

⥅ related node [[social mass sabotage]]

⥅ related node [[social media a critical introduction]]

⥅ related node [[social media is an important technology]]

⥅ related node [[social media is important because everything is social]]

⥅ related node [[social media]]

⥅ related node [[social metabolism]]

⥅ related node [[social model of disability]]

⥅ related node [[social movement theory]]

⥅ related node [[social movement]]

⥅ related node [[social ownership]]

⥅ related node [[social provisioning]]

⥅ related node [[social reader]]

⥅ related node [[social reproduction]]

⥅ related node [[social revolution is necessary in order to bring about structural changes to society]]

⥅ related node [[social revolution]]

⥅ related node [[social software]]

⥅ related node [[social solidarity]]

⥅ related node [[social taylorism]]

⥅ related node [[social tipping point]]

⥅ related node [[social transformation through the commons]]

⥅ related node [[socialisation of the internet]]

⥅ related node [[socialisation]]

⥅ related node [[socialise the series of tubes toward a democratic internet]]

⥅ related node [[socialism and ecology]]

⥅ related node [[socialism from below]]

⥅ related node [[socialism or barbarism]]

⥅ related node [[socialism utopian and scientific]]

⥅ related node [[socialism]]

⥅ related node [[socialisms diy computer]]

⥅ related node [[socialist agenda]]

⥅ related node [[socialist calculation debate]]

⥅ related node [[socialist chile]]

⥅ related node [[socialist economy]]

⥅ related node [[socialist planning]]

⥅ related node [[socialist revolution]]

⥅ related node [[socialist states the environment w salvatore engel di mauro]]

⥅ related node [[socialist workplaces]]

⥅ related node [[socialize the internet]]

⥅ related node [[socially necessary labour time]]

⥅ related node [[socially useful production]]

⥅ related node [[society for social studies of science]]

⥅ related node [[society for the protection of underground networks]]

⥅ related node [[sociocracy]]

⥅ related node [[software ecosystems]]

⥅ related node [[software for counterpower]]

⥅ related node [[software for libraries of things]]

⥅ related node [[software licence]]

⥅ related node [[software obsolescence]]

⥅ related node [[software services that i use]]

⥅ related node [[software sustainability]]

⥅ related node [[soil biome]]

⥅ related node [[soil]]

⥅ related node [[solar chargers]]

⥅ related node [[solar energy for digital communication systems]]

⥅ related node [[solar energy]]

⥅ related node [[solar farm]]

⥅ related node [[solar media collective]]

⥅ related node [[solar panels and gardening]]

⥅ related node [[solar panels]]

⥅ related node [[solar park]]

⥅ related node [[solar power]]

⥅ related node [[solar powered website]]

⥅ related node [[solar protocol]]

⥅ related node [[solar radiation management]]

⥅ related node [[solar system]]

⥅ related node [[solarpunk action week]]

⥅ related node [[solarpunk and storytelling the present and future]]

⥅ related node [[solarpunk books]]

⥅ related node [[solarpunk is not about pretty aesthetics its about the end of capitalism]]

⥅ related node [[solarpunk movies]]

⥅ related node [[solarpunks anxieties are global social injustice the failures of late capitalism and the climate crisis]]

⥅ related node [[solidarity economy association]]

⥅ related node [[solidarity economy]]

⥅ related node [[solidarity forged in difference]]

⥅ related node [[solidarity not charity]]

⥅ related node [[some books ive read]]

⥅ related node [[some files keep reappearing in syncthing]]

⥅ related node [[some small experiments in microblurting]]

⥅ related node [[sometimes seen as forerunners of modern anarchism]]

⥅ related node [[sonke ahrens]]

⥅ related node [[sortition]]

⥅ related node [[soul]]

⥅ related node [[south sudan]]

⥅ related node [[southbank centre]]

⥅ related node [[sovereign accountable commons]]

⥅ related node [[sovereign cloud stack]]

⥅ related node [[sovereignty for the commons]]

⥅ related node [[sovereignty]]

⥅ related node [[soviet communism]]

⥅ related node [[soviet cybernetics and the promise of big computer socialism]]

⥅ related node [[soviet cybernetics]]

⥅ related node [[soviet economy]]

⥅ related node [[soviet union]]

⥅ related node [[space cats fight fascism]]

⥅ related node [[space4]]

⥅ related node [[spaced repetition]]

⥅ related node [[spacemacs profile specific configuration]]

⥅ related node [[spacemacs]]

⥅ related node [[spaceship earth]]

⥅ related node [[spadework]]

⥅ related node [[spam]]

⥅ related node [[spanish civil war]]

⥅ related node [[spanish omelette]]

⥅ related node [[spanish revolution]]

⥅ related node [[spare parts for repair should be easily accessible]]

⥅ related node [[spare parts too expensive]]

⥅ related node [[spare parts]]

⥅ related node [[spatial software]]

⥅ related node [[speaker for the dead]]

⥅ related node [[special period]]

⥅ related node [[species being]]

⥅ related node [[spectre journal]]

⥅ related node [[speculating futures]]

⥅ related node [[speculative fiction]]

⥅ related node [[speculative outline]]

⥅ related node [[2022 02 05_12 54 29_screenshot]]

⥅ related node [[2022 02 05_12 55 25_screenshot]]

⥅ related node [[speeding up bulk archiving in org agenda]]

⥅ related node [[speeding up org export and org publish]]

⥅ related node [[speeding up org publish]]

⥅ related node [[spheres of commoning]]

⥅ related node [[spiderman syndrome]]

⥅ related node [[spinach and mushroom risotto]]

⥅ related node [[spirited away]]

⥅ related node [[spirituality]]

⥅ related node [[spokescouncil]]

⥅ related node [[spotify is going to ruin podcasting]]

⥅ related node [[spring statement 2022]]

⥅ related node [[spring statement 2024]]

⥅ related node [[spritely brux]]

⥅ related node [[spritely goblins]]

⥅ related node [[spritely updates november 2021]]

⥅ related node [[spritely]]

⥅ related node [[sprucing up an old windows 8 1 laptop]]

⥅ related node [[spycops]]

⥅ related node [[stable climate]]

⥅ related node [[stacco troncoso]]

⥅ related node [[stackoverflow]]

⥅ related node [[stacktivism]]

⥅ related node [[stadtwerke wolfhagen]]

⥅ related node [[stafford beer]]

⥅ related node [[stafford is going mad again]]

⥅ related node [[stagflation]]

⥅ related node [[stalinism]]

⥅ related node [[standard deviation and interquartile range]]

⥅ related node [[stanford universitys eugenicist agenda]]

⥅ related node [[starmers green growth plan]]

⥅ related node [[state control]]

⥅ related node [[state digital surveillance]]

⥅ related node [[state of nature]]

⥅ related node [[state power]]

⥅ related node [[state socialism is good for the environment]]

⥅ related node [[state socialism]]

⥅ related node [[state street global advisors]]

⥅ related node [[state surveillance]]

⥅ related node [[state violence]]

⥅ related node [[statebook]]

⥅ related node [[statecraft]]

⥅ related node [[statement google announces 10 years of tech support for chromebooks]]

⥅ related node [[steady state economy]]

⥅ related node [[steel boss dismisses claim that sector needs new cumbria coalmine]]

⥅ related node [[steel boss dismisses claim that sector needs new cumbrian coalmine]]

⥅ related node [[stefano harney]]

⥅ related node [[steve baker]]

⥅ related node [[steve rotheram]]

⥅ related node [[stigmergic production using choral explanations]]

⥅ related node [[stigmergy]]

⥅ related node [[stir to action]]

⥅ related node [[stir]]

⥅ related node [[stock and flow diagram]]

⥅ related node [[stock and flow]]

⥅ related node [[stock]]

⥅ related node [[stocks and flows]]

⥅ related node [[stokes croft land trust]]

⥅ related node [[stono rebellion]]

⥅ related node [[stop water pollution in the lake district]]

⥅ related node [[storing my ssh keys in keepassxc]]

⥅ related node [[storing secrets in emacs]]

⥅ related node [[strategies of protest with oscar berglund]]

⥅ related node [[strategy and tactics in anarchist politics]]

⥅ related node [[strategy and tactics]]

⥅ related node [[strategy]]

⥅ related node [[stream first]]

⥅ related node [[strike action]]

⥅ related node [[strike debt]]

⥅ related node [[structural adjustment program]]

⥅ related node [[structural violence]]

⥅ related node [[structure of feeling]]

⥅ related node [[sts]]

⥅ related node [[students for a democratic society]]

⥅ related node [[subcomandante marcos]]

⥅ related node [[subconscious beta]]

⥅ related node [[sublime tube]]

⥅ related node [[subsidiarity]]

⥅ related node [[suma]]

⥅ related node [[sun thinking]]

⥅ related node [[sunak comes unstuck]]

⥅ related node [[sunrise movement]]

⥅ related node [[super leverage points]]

⥅ related node [[supermarkets ready for a new week of rising to the virus s challenge]]

⥅ related node [[supermarkt berlin]]

⥅ related node [[superstore]]

⥅ related node [[supply and demand]]

⥅ related node [[supply chains]]

⥅ related node [[suppressed immune system]]

⥅ related node [[surfacing notes in my garden that have no claims]]

⥅ related node [[surrealism]]

⥅ related node [[sursiendo]]

⥅ related node [[surveillance capitalism]]

⥅ related node [[surveillance technology]]

⥅ related node [[surveillance]]

⥅ related node [[sustainable agriculture]]

⥅ related node [[sustainable consumption of goods promoting repair and reuse]]

⥅ related node [[sustainable consumption]]

⥅ related node [[sustainable development index]]

⥅ related node [[sustainable development mapping different approaches]]

⥅ related node [[sustainable development]]

⥅ related node [[sustainable tech]]

⥅ related node [[sustaphones]]

⥅ related node [[suzanne ciani]]

⥅ related node [[sweet tooth]]

⥅ related node [[swirl how]]

⥅ related node [[synchronized pomodoros]]

⥅ related node [[syncing a git repo within a syncthing folder]]

⥅ related node [[syncing my annotations from koreader]]

⥅ related node [[syncthing android doesnt sync until i restart or rescan]]

⥅ related node [[syncthing very slow on onyx boox note air plus 2]]

⥅ related node [[syndicalism]]

⥅ related node [[synergia mooc]]

⥅ related node [[synthesis anarchism]]

⥅ related node [[synthesis of horizontalism and verticalism]]

⥅ related node [[synthetic catallaxy]]

⥅ related node [[syria]]

⥅ related node [[sysadmin]]

⥅ related node [[system 360]]

⥅ related node [[system archetype]]

⥅ related node [[system archetypes i]]

⥅ related node [[system change]]

⥅ related node [[system dynamics a soft and hard approach to modelling]]

⥅ related node [[system dynamics]]

⥅ related node [[systematic]]

⥅ related node [[systemic and meta systemic laws]]

⥅ related node [[systemic design toolkit]]

⥅ related node [[systemic]]

⥅ related node [[systems and cybernetics]]

⥅ related node [[systems ecology]]

⥅ related node [[systems literacy]]

⥅ related node [[systems mapping]]

⥅ related node [[systems of influence]]

⥅ related node [[systems practice how to act]]

⥅ related node [[systems theory in political science]]

⥅ related node [[systems theory]]

⥅ related node [[systems thinking diagrams in plantuml]]

⥅ related node [[søren mau]]

⥅ related node [[t cell defences have proved far more robust against covid]]

⥅ related node [[t cell defences]]

⥅ related node [[tablet]]

⥅ related node [[tactics]]

⥅ related node [[tags vs folders]]

⥅ related node [[tailings]]

⥅ related node [[taiwan]]

⥅ related node [[taking fleeting notes with koreader]]

⥅ related node [[talk]]

⥅ related node [[talking to my daughter about the economy]]

⥅ related node [[taming big techification the european digital markets act]]

⥅ related node [[taming capitalism]]

⥅ related node [[taming the tech giants]]

⥅ related node [[tangential thinking]]

⥅ related node [[tarea vida]]

⥅ related node [[tariffs]]

⥅ related node [[tarot for thought]]

⥅ related node [[task management with org mode and orgzly]]

⥅ related node [[tau ceti]]

⥅ related node [[taxonomy of interoperability]]

⥅ related node [[taylorism]]

⥅ related node [[tcp ip]]

⥅ related node [[teaching the commons through the game of musical chairs]]

⥅ related node [[tech coops]]

⥅ related node [[tech exceptionalism]]

⥅ related node [[tech layoffs]]

⥅ related node [[tech wont save us]]

⥅ related node [[techlash]]

⥅ related node [[technical debt]]

⥅ related node [[technical documentation]]

⥅ related node [[2020 06 13_07 10 00_television test screen no signal vector illustration]]

⥅ related node [[technics]]

⥅ related node [[techno anarchism]]

⥅ related node [[techno feudalism]]

⥅ related node [[techno fixes]]

⥅ related node [[techno solutionism]]

⥅ related node [[techno utopianism]]

⥅ related node [[technocracy]]

⥅ related node [[technofeudalism w yanis varoufakis]]

⥅ related node [[technofeudalism what killed capitalism]]

⥅ related node [[technofeudalism]]

⥅ related node [[technological decentralisation]]

⥅ related node [[technological determinism]]

⥅ related node [[technological solutionism]]

⥅ related node [[technological sovereignty]]

⥅ related node [[technological utopianism]]

⥅ related node [[technology alone will not create a better world]]

⥅ related node [[technology and capitalism]]

⥅ related node [[technology and ecosocialism]]

⥅ related node [[technology and nature]]

⥅ related node [[technology and political economy]]

⥅ related node [[technology and revolution]]

⥅ related node [[technology appropriation in a de growing economy]]

⥅ related node [[technology capitalism]]

⥅ related node [[technology does not guarantee progress]]

⥅ related node [[technology is a site of struggle]]

⥅ related node [[technology networks for socially useful production]]

⥅ related node [[technology networks]]

⥅ related node [[technology of the oppressed w david nemer]]

⥅ related node [[technology of the oppressed]]

⥅ related node [[technology plays a significant role in political economy]]

⥅ related node [[technology should be liberatory]]

⥅ related node [[technology transfer]]

⥅ related node [[technology]]

⥅ related node [[technosocial imaginaries]]

⥅ related node [[ted kaczynski]]

⥅ related node [[telecentre]]

⥅ related node [[telecommunism]]

⥅ related node [[telekommunisten]]

⥅ related node [[telescope]]

⥅ related node [[temporary autonomous zone]]

⥅ related node [[tencent]]

⥅ related node [[teracube]]

⥅ related node [[termux]]

⥅ related node [[territorial sovereignty]]

⥅ related node [[tesa collective]]

⥅ related node [[testing my org export customisations with ert]]

⥅ related node [[2022 12 18_22 36 10_screenshot]]

⥅ related node [[textile industry]]

⥅ related node [[thai green curry]]

⥅ related node [[thatcherism]]

⥅ related node [[the ai crisis were ignoring]]

⥅ related node [[the anarchist library]]

⥅ related node [[the architecture of participation]]

⥅ related node [[the art and science of communism part 1 ft nick chavez phil neel]]

⥅ related node [[the assassination of john f kennedy]]

⥅ related node [[the average advertised rent outside london is 9 9 higher than a year ago]]

⥅ related node [[the basic rate of out of work benefits is at its lowest for 30 years]]

⥅ related node [[the black dog brutal five to one mix v2]]

⥅ related node [[the black dog dubs volume 4]]

⥅ related node [[the black panthers vanguard of the revolution]]

⥅ related node [[the blockchain socialist]]

⥅ related node [[the blog and wiki combo]]

⥅ related node [[the blue wall road trip tories jumping ship]]

⥅ related node [[the bold tactics that have kept iran protests going]]

⥅ related node [[the brain]]

⥅ related node [[the brilliant immanuel wallerstein was an anticapitalist until the end]]

⥅ related node [[the british digital cooperative a new model public sector institution]]

⥅ related node [[the built environment alienates us]]

⥅ related node [[the built environment reinforces cultural messages]]

⥅ related node [[the californian ideology]]

⥅ related node [[the carbon emissions of big tech]]

⥅ related node [[the care manifesto]]

⥅ related node [[the case against the professional managerial class with catherine liu]]

⥅ related node [[the case for digital degrowth]]

⥅ related node [[the cassini division]]

⥅ related node [[the cathedral and the bazaar]]

⥅ related node [[the central memory]]

⥅ related node [[the cheese project]]

⥅ related node [[the city the city]]

⥅ related node [[the cleaners]]

⥅ related node [[the climate crisis is a space of class struggle]]

⥅ related node [[the climate crisis is global but councils can offer local solutions]]

⥅ related node [[the cloud]]

⥅ related node [[the co operativist challenge to the platform economy]]

⥅ related node [[the comma strike]]

⥅ related node [[the commodification of social activities]]

⥅ related node [[the common place]]

⥅ related node [[the commoners catalog for changemaking]]

⥅ related node [[the commons enables people to assert sovereignty without nationalism]]

⥅ related node [[the commons enables people to enjoy freedom without repressing others]]

⥅ related node [[the commons enables people to foster togetherness without compulsion]]

⥅ related node [[the commons short and sweet]]

⥅ related node [[the communalist project]]

⥅ related node [[the computer built to last 50 years]]

⥅ related node [[the conditions of the working class in england]]

⥅ related node [[the conquest of bread]]

⥅ related node [[the cost of free shipping]]

⥅ related node [[the cragg]]

⥅ related node [[the culture]]

⥅ related node [[the cybernetic brain]]

⥅ related node [[the cybernetic hypothesis]]

⥅ related node [[the cybernetic jacket]]

⥅ related node [[the cybersyn revolution]]

⥅ related node [[the dads of tech]]

⥅ related node [[the dangers of digital capitalism]]

⥅ related node [[the dawn of everything]]

⥅ related node [[the death of nature]]

⥅ related node [[the death of the unabomber will his dangerous influence live on]]

⥅ related node [[the decentralized web of hate]]

⥅ related node [[the dialectics of space]]

⥅ related node [[the digital revolution has failed]]

⥅ related node [[the digital sector under capitalism]]

⥅ related node [[the disco elements]]

⥅ related node [[the dispossessed]]

⥅ related node [[the divide]]

⥅ related node [[the double objective of democratic ecosocialism]]

⥅ related node [[the dream of superabundance is over]]

⥅ related node [[the ecologist]]

⥅ related node [[the ecology of freedom]]

⥅ related node [[the economics of the coming spaceship earth]]

⥅ related node [[the electronic agora]]

⥅ related node [[the electronic left]]

⥅ related node [[the emergence of blogging]]

⥅ related node [[the end of capitalism]]

⥅ related node [[the end of ownership]]

⥅ related node [[the end of policing]]

⥅ related node [[the end of the world]]

⥅ related node [[the engine room]]

⥅ related node [[the engineers plot]]

⥅ related node [[the entropy of capitalism]]

⥅ related node [[the environmental impact of a playstation 4]]

⥅ related node [[the era of fixing your own phone has nearly arrived]]

⥅ related node [[the eu battery directive will make it easier to replace batteries]]

⥅ related node [[the eu has no homegrown big tech companies of its own]]

⥅ related node [[the falcon and the winter soldier]]

⥅ related node [[the fall of the berlin wall]]

⥅ related node [[the fire these times]]

⥅ related node [[the first rule of spectacle club]]

⥅ related node [[the fossil politics of texas]]

⥅ related node [[the fractal prince]]

⥅ related node [[the framing paradox]]

⥅ related node [[the free software movement is an example of neo luddism]]

⥅ related node [[the future is degrowth]]

⥅ related node [[the future of digital cooperatives]]

⥅ related node [[the future of food how to achieve radical change with george monbiot]]

⥅ related node [[the future of work]]

⥅ related node [[the garden and the stream a technopastoral]]

⥅ related node [[the garden]]

⥅ related node [[the generative ai race has a dirty secret]]

⥅ related node [[the global e waste monitor 2020]]

⥅ related node [[the good place]]

⥅ related node [[the goose and the common]]

⥅ related node [[the government should invest in the nhs not privatise it]]

⥅ related node [[the great carbon divide]]

⥅ related node [[the great unfettering]]

⥅ related node [[the green transition the problem with green capitalism part 1]]

⥅ related node [[the green transition the problem with green capitalism]]

⥅ related node [[the guardian]]

⥅ related node [[the hackerist perspective]]

⥅ related node [[the hammer bill gates wants your money]]

⥅ related node [[the hi tech gift economy]]

⥅ related node [[the high cost of uber s small profit]]

⥅ related node [[the human condition]]

⥅ related node [[the humanization of nature]]

⥅ related node [[the hunger games]]

⥅ related node [[the importance of joining class struggle with climate action]]

⥅ related node [[the importance of social media]]

⥅ related node [[the indieweb and the right to repair are related]]

⥅ related node [[the information necessary for repair should be easily accessible]]

⥅ related node [[the insect crisis where did all the bugs go]]

⥅ related node [[the insect crisis]]

⥅ related node [[the interconnectedness of life]]

⥅ related node [[the internet as a super commons]]

⥅ related node [[the internet con]]

⥅ related node [[the jakarta method comes to latin america review]]

⥅ related node [[the judgement of paris facebook vs the communards]]

⥅ related node [[the knowledge ecology]]

⥅ related node [[the left hand of darkness]]

⥅ related node [[the left]]

⥅ related node [[the librarian]]

⥅ related node [[the limits of togetherness]]

⥅ related node [[the limits to growth]]

⥅ related node [[the local businesses giving your stuff a second life]]

⥅ related node [[the long way to a small angry planet]]

⥅ related node [[the lucas plan]]

⥅ related node [[the machine stops]]

⥅ related node [[the magic of small databases]]

⥅ related node [[the maintainers]]

⥅ related node [[the making of the english working class]]

⥅ related node [[the map is not the territory is backwards]]

⥅ related node [[the map is not the territory]]

⥅ related node [[the map]]

⥅ related node [[the market for intellectual property]]

⥅ related node [[the material power that rules computation ft cory doctorow]]

⥅ related node [[the matrix of convivial technology assessing technologies for degrowth]]

⥅ related node [[the means of connection]]

⥅ related node [[the means of production are heavily reliant on technology]]

⥅ related node [[the mechanic and the luddite]]

⥅ related node [[the menace of trumpism is darker now than it ever was before]]

⥅ related node [[the ministry for the future climate change sci fi and our near future]]

⥅ related node [[the ministry for the future]]

⥅ related node [[the missing revolution w vincent bevins]]

⥅ related node [[the monkey wrench gang]]

⥅ related node [[the movements of the squares]]

⥅ related node [[the mute compulsion of capitalism]]

⥅ related node [[the myth of freedom under capitalism]]

⥅ related node [[the mythology of cybersyn ft evgeny morozov]]

⥅ related node [[the nature of lisp]]

⥅ related node [[the nature of technology]]

⥅ related node [[the next american revolution]]

⥅ related node [[the next system]]

⥅ related node [[the next uk election will be decided in the north of england]]

⥅ related node [[the observer view on the woeful state of englands water industry]]

⥅ related node [[the ocean plays a critical role in maintaining a stable climate]]

⥅ related node [[the pattern language of project xanadu]]

⥅ related node [[the patterning instinct]]

⥅ related node [[the people vs climate change]]

⥅ related node [[the peoples front of judea]]

⥅ related node [[the peoples platform]]

⥅ related node [[the peoples republic of walmart]]

⥅ related node [[the perverts guide to cinema]]

⥅ related node [[the philosophy of murray bookchin an interview with debbie bookchin]]

⥅ related node [[the player of games]]

⥅ related node [[the police]]

⥅ related node [[the policing bill is about state control]]

⥅ related node [[the policing bill is an embrace of a new authoritarianism]]

⥅ related node [[the political economy of solarpunk with andrew dana hudson]]

⥅ related node [[the politics of the commons reform or revolt]]

⥅ related node [[the potential of crossposting]]

⥅ related node [[the preston model]]

⥅ related node [[the privatisation of manchester]]

⥅ related node [[the problem with america s ban on tiktok]]

⥅ related node [[the public service media and public service internet manifesto]]

⥅ related node [[the purpose of a system is what it does]]

⥅ related node [[the quantum thief]]

⥅ related node [[the radical imagination in reactionary times]]

⥅ related node [[the radical imagination of the paris commune]]

⥅ related node [[the reboot playbook 2020]]

⥅ related node [[the reboot]]

⥅ related node [[the received wisdom]]

⥅ related node [[the red army faction marxist guerrilla warfare in west germany]]

⥅ related node [[the rent is too damn high]]

⥅ related node [[the revolution is continuous]]

⥅ related node [[the revolution will be networked]]

⥅ related node [[the right to repair movement is an example of neo luddism]]

⥅ related node [[the road to serfdom]]

⥅ related node [[the rocky road to a real transition]]

⥅ related node [[the role of culture in politics]]

⥅ related node [[the role of software for a universal right to repair]]

⥅ related node [[the role of technology in eco socialism]]

⥅ related node [[the sane society]]

⥅ related node [[the santiago boys]]

⥅ related node [[the secret water footprint of ai technology]]

⥅ related node [[the security state]]

⥅ related node [[the shock doctrine of the left]]

⥅ related node [[the shock doctrine]]

⥅ related node [[the silencing of climate protesters in english and welsh courts]]

⥅ related node [[the silicon empire in eastern europe ft erin mcelroy]]

⥅ related node [[the social industry is a simulacrum]]

⥅ related node [[the social life of commoning]]

⥅ related node [[the socialist spoon]]

⥅ related node [[the society of the spectacle]]

⥅ related node [[the software commons is one of the great commons of modern times]]

⥅ related node [[the spectacle]]

⥅ related node [[the speed cubers]]

⥅ related node [[the stack as an integrative model of global capitalism]]

⥅ related node [[the stack on software and sovereignty]]

⥅ related node [[the stack]]

⥅ related node [[the state and revolution]]

⥅ related node [[the stigmergic revolution]]

⥅ related node [[the structural violence of the information age]]

⥅ related node [[the stubborn vitality of the gift economy]]

⥅ related node [[the sunset of the californian ideology w richard barbrook]]

⥅ related node [[the supermarket into prison pipeline]]

⥅ related node [[the system]]

⥅ related node [[the tao of physics]]

⥅ related node [[the tao of wao s09 episode 4 adam greenfield]]

⥅ related node [[the technologies of all dead generations]]

⥅ related node [[the telekommunist manifesto]]

⥅ related node [[the tethered economy]]

⥅ related node [[the third man]]

⥅ related node [[the three body problem]]

⥅ related node [[the topology of information networks]]

⥅ related node [[the tories keep on stymying onshore wind]]

⥅ related node [[the tory leadership race and the ghost of margaret thatcher]]

⥅ related node [[the twittering machine book]]

⥅ related node [[the twittering machine]]

⥅ related node [[the tyranny of openness what happened to peer production]]

⥅ related node [[the tyranny of structurelessness]]

⥅ related node [[the uber files the unicorn]]

⥅ related node [[the uk energy strategy is terrible]]

⥅ related node [[the uk s new right to repair is not a right to repair]]

⥅ related node [[the uk should have a national programme of home insulation]]

⥅ related node [[the uk should not focus so heavily on recycling]]

⥅ related node [[the uk should put more focus higher up the waste hierarchy]]

⥅ related node [[the uks energy bill crisis explained]]

⥅ related node [[the ultimate eco building made of salt sunflowers and recycled urine]]

⥅ related node [[the use and abuse of vegetational concepts]]

⥅ related node [[the utopian internet computing communication and concrete utopias]]

⥅ related node [[the value of a whale with adrienne buller]]

⥅ related node [[the value of a whale]]

⥅ related node [[the virtual class]]

⥅ related node [[the virtual community]]

⥅ related node [[the vulgar and the strange web]]

⥅ related node [[the waste land]]

⥅ related node [[the weather underground]]

⥅ related node [[the web of death ft tamara kneese]]

⥅ related node [[the web of life]]

⥅ related node [[the web of meaning]]

⥅ related node [[the week in green software disintegration vs integration]]

⥅ related node [[the week in green software green software legislation]]

⥅ related node [[the week the world woke up to russian war crimes in ukraine]]

⥅ related node [[the wise democratic government takes note of large scale protest]]

⥅ related node [[the wobblies]]

⥅ related node [[the word for world is forest]]

⥅ related node [[the world of mesh networking with elektra wagenrad]]

⥅ related node [[the worlds largest technology companies in 2023 a new leader emerges]]

⥅ related node [[the wretched of the earth]]

⥅ related node [[the year 200]]

⥅ related node [[the year of the squeeze]]

⥅ related node [[2020 05 24_12 14 44_simulacres_et_simulation]]

⥅ related node [[thea riofrancos]]

⥅ related node [[theodor adorno]]

⥅ related node [[theories of international politics and zombies]]

⥅ related node [[theory of change]]

⥅ related node [[theory of collective action]]

⥅ related node [[theory of the derive]]

⥅ related node [[theory]]

⥅ related node [[therapy in virtual reality]]

⥅ related node [[there are different strands of cybernetics]]

⥅ related node [[there are multiple types of markets]]

⥅ related node [[there is a latent fascist waiting to emerge in all humans]]

⥅ related node [[there is a layer of governance infrastructure missing from the web]]

⥅ related node [[there is no capitalism without colonialism]]

⥅ related node [[there is no such thing as an ungoverned space]]

⥅ related node [[there is no such thing as knowledge]]

⥅ related node [[there is no such thing as society]]

⥅ related node [[there is such a thing as society]]

⥅ related node [[there s hope yet for uk waste and repair policy with green alliance]]

⥅ related node [[there will be a fresh wave of omicron cases in the early summer]]

⥅ related node [[thermodynamics]]

⥅ related node [[they cloned tyrone]]

⥅ related node [[thick time]]

⥅ related node [[thinking prompts]]

⥅ related node [[thinkpad t14]]

⥅ related node [[third industrial revolution]]

⥅ related node [[third wave internet with ben tarnoff]]

⥅ related node [[third worldism]]

⥅ related node [[this is fine optimism and emergency in the decentralised network]]

⥅ related node [[this land is our land]]

⥅ related node [[this machine kills]]

⥅ related node [[thomas hanna]]

⥅ related node [[thomas hobbes]]

⥅ related node [[thomas malthus]]

⥅ related node [[thomas paine]]

⥅ related node [[thomas sankara]]

⥅ related node [[thomas schelling]]

⥅ related node [[thomas spence]]

⥅ related node [[thompson morrison]]

⥅ related node [[thoughts on ostroms rules for radicals chapter 1]]

⥅ related node [[thoughts on ostroms rules for radicals chapter 2]]

⥅ related node [[threaded twitter]]

⥅ related node [[tidal power]]

⥅ related node [[tiddlers]]

⥅ related node [[tim jackson the quest for post growt]]

⥅ related node [[tim jackson the quest for post growth]]

⥅ related node [[tim jackson]]

⥅ related node [[time for action]]

⥅ related node [[time well spent]]

⥅ related node [[timebanking]]

⥅ related node [[timeblocking]]

⥅ related node [[tipping point]]

⥅ related node [[tiqqun]]

⥅ related node [[titles for things]]

⥅ related node [[titling evergreen notes]]

⥅ related node [[tiwa]]

⥅ related node [[tmk bc5 mute compulsion ch 1]]

⥅ related node [[tmk bc5 mute compulsion ch 2]]

⥅ related node [[tmk bc5 mute compulsion introduction]]

⥅ related node [[to be a 21st century socialist is to be an eco socialist]]

⥅ related node [[to be a 21st century socialist is to be an ecosocialist]]

⥅ related node [[to be ready for anything without planning for everything]]

⥅ related node [[to file]]

⥅ related node [[to posterity bertolt brecht]]

⥅ related node [[to posterity]]

⥅ related node [[to talk of organization on nunes neither vertical nor horizotal]]

⥅ related node [[today in focus]]

⥅ related node [[tom critchlow]]

⥅ related node [[tom]]

⥅ related node [[ton]]

⥅ related node [[tons way of organising feeds]]

⥅ related node [[tony blair]]

⥅ related node [[tool libraries]]

⥅ related node [[tools for thought and conversation theory]]

⥅ related node [[tools for thought the first 300000 years]]

⥅ related node [[topic clustering in org roam graphs]]

⥅ related node [[topic map]]

⥅ related node [[topic modeling]]

⥅ related node [[topological determinism]]

⥅ related node [[tor and wordfence]]

⥅ related node [[tor]]

⥅ related node [[tories]]

⥅ related node [[total perspective vortex]]

⥅ related node [[total planning]]

⥅ related node [[totalitarianism]]

⥅ related node [[totality]]

⥅ related node [[tour bus stop]]

⥅ related node [[toussaint louverture]]

⥅ related node [[tout le monde deteste la police]]

⥅ related node [[toward a digital economy that s truly collaborative not exploitative]]

⥅ related node [[towards a liberatory technology]]

⥅ related node [[towards governable stacks]]

⥅ related node [[towards socialism and the end of capitalism an introduction]]

⥅ related node [[towards socialism]]

⥅ related node [[toxic colonialism]]

⥅ related node [[tpm 2 0]]

⥅ related node [[tpm is rarely used to protect users]]

⥅ related node [[tpm is used overwhelmingly to protect media conglomerates]]

⥅ related node [[tracks that i have liked at some point in my life in no particular order]]

⥅ related node [[trade unionism]]

⥅ related node [[trade unions]]

⥅ related node [[traditional irrigation]]

⥅ related node [[tragedy of the commons]]

⥅ related node [[tragedy of the digital commons]]

⥅ related node [[tragedy of the time horizon]]

⥅ related node [[tragedy]]

⥅ related node [[transclusion in emacs]]

⥅ related node [[transition research network pattern language]]

⥅ related node [[transition research network]]

⥅ related node [[transition together summit]]

⥅ related node [[transition town tooting]]

⥅ related node [[transition]]

⥅ related node [[transnational institute]]

⥅ related node [[transparent algorithms]]

⥅ related node [[trasformismo]]

⥅ related node [[traversal network of feminist servers]]

⥅ related node [[trebor scholz on platform cooperativism]]

⥅ related node [[trebor scholz]]

⥅ related node [[tredegar medical aid society]]

⥅ related node [[tree planting]]

⥅ related node [[tri repetae]]

⥅ related node [[triad of commoning]]

⥅ related node [[triangulation in qualitative research]]

⥅ related node [[tribune winter 2022]]

⥅ related node [[tribune]]

⥅ related node [[trip 20 revolution]]

⥅ related node [[trip 22 democracy]]

⥅ related node [[trip 24 technology]]

⥅ related node [[trip 30 gifts]]

⥅ related node [[trip 33 comedy]]

⥅ related node [[trip 34 the outdoors]]

⥅ related node [[trip 35 the internet]]

⥅ related node [[trip 39 protest]]

⥅ related node [[trip 49 debt]]

⥅ related node [[triplec]]

⥅ related node [[trivial and non trivial machines]]

⥅ related node [[tron legacy]]

⥅ related node [[tron]]

⥅ related node [[trump is guilty on all counts so what happens next]]

⥅ related node [[trumpism]]

⥅ related node [[trust situated knowing]]

⥅ related node [[trusted commons why old social media matter]]

⥅ related node [[trustedreviews com adds sustainability criteria to reviews]]

⥅ related node [[trustedreviews com]]

⥅ related node [[truth social]]

⥅ related node [[trying out calfw blocks]]

⥅ related node [[trying out org timeblock]]

⥅ related node [[trying to install a custom rom on sony xperia z1 compact]]

⥅ related node [[tufte css]]

⥅ related node [[turning an old laptop keyboard into a portable usb keyboard]]

⥅ related node [[turning issues into demands]]

⥅ related node [[turning on case insensitive search in org roam]]

⥅ related node [[turning the earth into money w john bellamy foster]]

⥅ related node [[tutanota]]

⥅ related node [[tv ive enjoyed watching]]

⥅ related node [[tv show]]

⥅ related node [[tweaking doom emacs to use spc spc]]

⥅ related node [[tweaks to org agenda on mobile to save space]]

⥅ related node [[twenty first century socialism]]

⥅ related node [[twin pages]]

⥅ related node [[twitter and tear gas]]

⥅ related node [[two lives changed by the death of george floyd]]

⥅ related node [[type of markets]]

⥅ related node [[types of ecosocialism]]

⥅ related node [[types of markets]]

⥅ related node [[types of systems thinking]]

⥅ related node [[tyre extinguishers]]

⥅ related node [[tyskysour the tories have broken britain]]

⥅ related node [[tyskysour]]

⥅ related node [[uber files]]

⥅ related node [[uber]]

⥅ related node [[ubuntu 20 04 basic server setup]]

⥅ related node [[ubuntu 20 04 server setup at greenhost]]

⥅ related node [[ubuntu rationality]]

⥅ related node [[ufw]]

⥅ related node [[uganda]]

⥅ related node [[uk avian flu 2022]]

⥅ related node [[uk energy bill crisis]]

⥅ related node [[uk energy strategy]]

⥅ related node [[uk energy supply strategy]]

⥅ related node [[uk fuel crisis 2021]]

⥅ related node [[uk government]]

⥅ related node [[uk politics]]

⥅ related node [[uk recession 2022]]

⥅ related node [[uk repair and reuse declaration]]

⥅ related node [[uk supply chain crisis 2021]]

⥅ related node [[uk water shortages 2022]]

⥅ related node [[uk100]]

⥅ related node [[ukraine]]

⥅ related node [[ulises mejias]]

⥅ related node [[ultra rich nerd tycoons]]

⥅ related node [[ulverston lantern festival]]

⥅ related node [[ulverston repair cafe february 2024]]

⥅ related node [[ulverston repair cafe march 2024]]

⥅ related node [[ulverston repair cafe november 2023]]

⥅ related node [[ulverston repair cafe october 2024]]

⥅ related node [[ulverston repair cafe]]

⥅ related node [[un convention on biological diversity]]

⥅ related node [[unconscious r d]]

⥅ related node [[undoing optimization civic action in smart cities]]

⥅ related node [[unemployment for all]]

⥅ related node [[unequal exchange]]

⥅ related node [[ungoverned space]]

⥅ related node [[union busting]]

⥅ related node [[unionisation]]

⥅ related node [[unionization of creatives at vice media]]

⥅ related node [[united kingdom]]

⥅ related node [[united states]]

⥅ related node [[unitierra]]

⥅ related node [[universal basic income or universal basic services]]

⥅ related node [[universal basic services the power of decommodifying survival]]

⥅ related node [[universal basic services]]

⥅ related node [[universal care]]

⥅ related node [[universal credit]]

⥅ related node [[universal health care]]

⥅ related node [[universal right to repair]]

⥅ related node [[unknown specializer org roam node]]

⥅ related node [[unnecessary technology]]

⥅ related node [[up go]]

⥅ related node [[upcycling android]]

⥅ related node [[upcycling broken laptops]]

⥅ related node [[updating my approach to window management and emacs]]

⥅ related node [[updating spacemacs 2024 03 12]]

⥅ related node [[updating to emacs 28 on linux mint]]

⥅ related node [[updating to emacs 29 on linux mint]]

⥅ related node [[updating to org roam 1 2 2]]

⥅ related node [[updating to org roam 1 2 3]]

⥅ related node [[updating to yunohost 11]]

⥅ related node [[upgrading linux mint 19 2 to 19 3]]

⥅ related node [[upgrading linux mint 19 3 to linux mint 20]]

⥅ related node [[upgrading linux mint 20 3 to 22]]

⥅ related node [[upgrading linux mint 20 to 20 3]]

⥅ related node [[upload]]

⥅ related node [[upstream]]

⥅ related node [[urban garden]]

⥅ related node [[urban mining]]

⥅ related node [[us intervention]]

⥅ related node [[us pirgs best laptop brands for repairability]]

⥅ related node [[us trade deficit]]

⥅ related node [[use convivial tools]]

⥅ related node [[use of weapons]]

⥅ related node [[use value]]

⥅ related node [[user freedom]]

⥅ related node [[using emergence to take social innovation to scale]]

⥅ related node [[using filetags for marking nodes in org roam as zettelkasten main notes]]

⥅ related node [[using firn for publishing my org roam digital garden]]

⥅ related node [[using fuzzy links aka wikilinks in org roam]]

⥅ related node [[using icts to support ecosocialist governance]]

⥅ related node [[using org mode for timeblocking]]

⥅ related node [[using ox hugo for publishing my org roam digital garden]]

⥅ related node [[using python in org]]

⥅ related node [[using solar panels for the home]]

⥅ related node [[using ssh keys in termux for git]]

⥅ related node [[using the news app from f droid to connect to miniflux on android]]

⥅ related node [[utilitarianism]]

⥅ related node [[utopian socialism]]

⥅ related node [[utopian]]

⥅ related node [[utopianism]]

⥅ related node [[utopophobia]]

⥅ related node [[utrecht]]

⥅ related node [[v for vendetta]]

⥅ related node [[vaccine equity]]

⥅ related node [[vaccine hoarding]]

⥅ related node [[vaccine nationalism]]

⥅ related node [[vaccines make an important difference in who develops the illness]]

⥅ related node [[vaclav smil]]

⥅ related node [[vagabonds]]

⥅ related node [[value flow accounting]]

⥅ related node [[value flows]]

⥅ related node [[value]]

⥅ related node [[valueflows]]

⥅ related node [[valve]]

⥅ related node [[vancouver public library]]

⥅ related node [[vandana shiva]]

⥅ related node [[vanguard party]]

⥅ related node [[vanguard stack]]

⥅ related node [[vanguard stacks self governing against digital colonialism]]

⥅ related node [[vanguardism]]

⥅ related node [[vector]]

⥅ related node [[vectoralist class]]

⥅ related node [[veganism]]

⥅ related node [[vegetarian]]

⥅ related node [[vehicle to grid]]

⥅ related node [[venkatesh rao]]

⥅ related node [[ventilators]]

⥅ related node [[venture communism]]

⥅ related node [[verso]]

⥅ related node [[verticalism]]

⥅ related node [[viable system model]]

⥅ related node [[victor glushkov]]

⥅ related node [[video embeds]]

⥅ related node [[vietnam war]]

⥅ related node [[vijay prashad]]

⥅ related node [[viktor glushkov]]

⥅ related node [[viktor orban]]

⥅ related node [[vincent bevins]]

⥅ related node [[virtual class]]

⥅ related node [[virtual reality]]

⥅ related node [[virtual world]]

⥅ related node [[vision pro]]

⥅ related node [[visual thinking]]

⥅ related node [[vita activa]]

⥅ related node [[voice notes]]

⥅ related node [[voices of fixfest uk 2023]]

⥅ related node [[vpns]]

⥅ related node [[vps providers using renewable energy]]

⥅ related node [[vps providers]]

⥅ related node [[vue]]

⥅ related node [[vulpea]]

⥅ related node [[w brian arthur part 1 on the history of complexity economics]]

⥅ related node [[w brian arthur]]

⥅ related node [[w e b du bois]]

⥅ related node [[wallabag]]

⥅ related node [[walmart]]

⥅ related node [[walney island]]

⥅ related node [[walney wind farm]]

⥅ related node [[walter rodney]]

⥅ related node [[wandering the web]]

⥅ related node [[wannacry]]

⥅ related node [[wapping dispute]]

⥅ related node [[war communism]]

⥅ related node [[war games]]

⥅ related node [[warren weaver]]

⥅ related node [[washington consensus]]

⥅ related node [[waste disposal]]

⥅ related node [[waste hierarchy]]

⥅ related node [[waste picker]]

⥅ related node [[waste streams]]

⥅ related node [[waste]]

⥅ related node [[wasteland]]

⥅ related node [[watched]]

⥅ related node [[water cycle]]

⥅ related node [[water from the stream]]

⥅ related node [[water industry]]

⥅ related node [[water pollution in the lake district]]

⥅ related node [[water pollution]]

⥅ related node [[water privatisation]]

⥅ related node [[water shortage]]

⥅ related node [[water supply system]]

⥅ related node [[ways of being]]

⥅ related node [[ways to reclaim the stacks]]

⥅ related node [[wcv s2 keir milburn glorious variation in the global working class]]

⥅ related node [[wcv s2 weve run with it like a dog with a burst ball]]

⥅ related node [[wcv2 duncan exley working class campaigners want to change things]]

⥅ related node [[we all should be botanists interview with leif bersweden]]

⥅ related node [[we are commoners]]

⥅ related node [[we are currently on track for catastrophic 3c heating]]

⥅ related node [[we do not have vaccine equity]]

⥅ related node [[we know we have more work to do]]

⥅ related node [[we need to eliminate the private insurance sector]]

⥅ related node [[we need vaccine equity]]

⥅ related node [[we should have public ownership of energy]]

⥅ related node [[we should have public ownership of water]]

⥅ related node [[we should phase out intellectual property]]

⥅ related node [[we should socialise ict infrastructure]]

⥅ related node [[we should socialise the platforms]]

⥅ related node [[wealth and income]]

⥅ related node [[wealth inequality]]

⥅ related node [[wealth]]

⥅ related node [[weaponised design]]

⥅ related node [[weather underground]]

⥅ related node [[weaving the web]]

⥅ related node [[web 1 0]]

⥅ related node [[web 2 0]]

⥅ related node [[web 3 0]]

⥅ related node [[web industry]]

⥅ related node [[web literacy]]

⥅ related node [[web mode]]

⥅ related node [[web renewal]]

⥅ related node [[web ring]]

⥅ related node [[web sign in]]

⥅ related node [[week 12 2020]]

⥅ related node [[weeknotes w26 2022]]

⥅ related node [[weeknotes w27 2022]]

⥅ related node [[weeknotes w28 2022]]

⥅ related node [[weeknotes w29 2022]]

⥅ related node [[weeknotes w30 2022]]

⥅ related node [[2020 46]]

⥅ related node [[2020 48]]

⥅ related node [[2020 49]]

⥅ related node [[2020 50]]

⥅ related node [[weeknotes 2020 21]]

⥅ related node [[weeknotes 2020 22]]

⥅ related node [[weeknotes 2020 23]]

⥅ related node [[weeknotes 2020 45]]

⥅ related node [[weeknotes 2020 46]]

⥅ related node [[yakshave]]

⥅ related node [[weird corridors]]

⥅ related node [[weird music]]

⥅ related node [[weird web]]

⥅ related node [[weird]]

⥅ related node [[welfare state]]

⥅ related node [[well connected]]

⥅ related node [[wendy carlos]]

⥅ related node [[were about to learn a terrible lesson from coronavirus inequality kills]]

⥅ related node [[were mowed over colossal data centers are taking over the us countryside]]

⥅ related node [[west cumbria mining]]

⥅ related node [[western maoism]]

⥅ related node [[westmorland and furness]]

⥅ related node [[wet bulb temperature]]

⥅ related node [[what are the similarities and differences between agora and fedwiki]]

⥅ related node [[what could governance online look like]]

⥅ related node [[what do i think about the agora]]

⥅ related node [[what do the tories consider extreme]]

⥅ related node [[what does a solarpunk city look like]]

⥅ related node [[what does an ecological civilization look like]]

⥅ related node [[what does class mean now]]

⥅ related node [[what does it mean to care and repair]]

⥅ related node [[what happens to your waste with oliver franklin wallis]]

⥅ related node [[what if its a big hoax and we create a better world for nothing]]

⥅ related node [[what if links werent meant to be prose]]

⥅ related node [[what inspiration should we take from the paris commune]]

⥅ related node [[what is captp and what does it enable]]

⥅ related node [[what is conversation]]

⥅ related node [[what is life]]

⥅ related node [[what is the itu doing on sustainability]]

⥅ related node [[what is the relationship between cooperatives and the commons]]

⥅ related node [[what is the relationship of technology and politics]]

⥅ related node [[what is to be done who is going to do it and where]]

⥅ related node [[what is to be done with breht oshea and alyson escalante]]

⥅ related node [[what is to be done]]

⥅ related node [[what is true digital inclusion]]

⥅ related node [[what is web 3 0]]

⥅ related node [[what is wrong with a system of laissez faire economics]]

⥅ related node [[what s the value of data ft salome viljoen]]

⥅ related node [[what social media meant for the mass protest decade w vincent bevins]]

⥅ related node [[what would ai for the people look like]]

⥅ related node [[whats new in emacs 28]]

⥅ related node [[whats the difference between agency and autonomy]]

⥅ related node [[whats the difference between digital commons and knowledge commons]]

⥅ related node [[whats the difference between my journal and my stream]]

⥅ related node [[whats the political philosophy of the indieweb]]

⥅ related node [[whats wrong with using google fonts]]

⥅ related node [[whats wrong with whatsapp]]

⥅ related node [[wheel of the year]]

⥅ related node [[when bringing change we must minimise violence]]

⥅ related node [[when did you join the indieweb]]

⥅ related node [[when preston meets the doughnut]]

⥅ related node [[when we repair something we think about its history and provenance]]

⥅ related node [[where there are people there is governance]]

⥅ related node [[which municipalism lets be choosy]]

⥅ related node [[white collar bloodbath]]

⥅ related node [[whitehaven]]

⥅ related node [[whiteness]]

⥅ related node [[who creates commons public partnerships]]

⥅ related node [[why are co ops relevant in a time of political and economic crisis]]

⥅ related node [[why debian]]

⥅ related node [[why does agile fail]]

⥅ related node [[why ethical consumerism is a trap]]

⥅ related node [[why have a personal wiki]]

⥅ related node [[why is agency important]]

⥅ related node [[why is england so vulnerable to droughts]]

⥅ related node [[why its eco socialism or collapse]]

⥅ related node [[why spaced repetition doesnt always work]]

⥅ related node [[why tech makes us more insecure w astra taylor]]

⥅ related node [[why we need socialism]]

⥅ related node [[wide data]]

⥅ related node [[widespread racial inequality is embedded in healthcare in england]]

⥅ related node [[wiki content]]

⥅ related node [[wiki entry point]]

⥅ related node [[wiki gardening]]

⥅ related node [[wiki graphs]]

⥅ related node [[wiki itches]]

⥅ related node [[wiki links are my tags]]

⥅ related node [[wiki nature]]

⥅ related node [[2020 04 04_09 39 41_screenshot]]

⥅ related node [[2020 05 09_11 18 18_screenshot]]

⥅ related node [[wikilinks vs tags]]

⥅ related node [[wikilinks which are phrases]]

⥅ related node [[wikinode]]

⥅ related node [[wikis as hypertexts]]

⥅ related node [[wikis as neurons]]

⥅ related node [[wikis i like]]

⥅ related node [[wikis with personality]]

⥅ related node [[wikity]]

⥅ related node [[wild design]]

⥅ related node [[will trump s tariffs tip the world into recession]]

⥅ related node [[william cuffay]]

⥅ related node [[william godwin]]

⥅ related node [[william morris]]

⥅ related node [[williamson park]]

⥅ related node [[wind farm]]

⥅ related node [[wind farms appeal to voters across the parties]]

⥅ related node [[wind power]]

⥅ related node [[wind turbines]]

⥅ related node [[windermere]]

⥅ related node [[windows 10 end of life]]

⥅ related node [[windows 11]]

⥅ related node [[windpunk]]

⥅ related node [[wings]]

⥅ related node [[winter of discontent]]

⥅ related node [[withering away of the state]]

⥅ related node [[without a doubt]]

⥅ related node [[woman on the edge of time]]

⥅ related node [[wonder woman]]

⥅ related node [[wood wide web]]

⥅ related node [[word counts in org mode]]

⥅ related node [[wordfence]]

⥅ related node [[wordpress backups]]

⥅ related node [[wordpress error connecting to database]]

⥅ related node [[wordpress]]

⥅ related node [[work life balance]]

⥅ related node [[work log 2023 11 27]]

⥅ related node [[work notes 2024 02 26]]

⥅ related node [[worker cooperatives]]

⥅ related node [[worker coops and consulting]]

⥅ related node [[worker empowerment]]

⥅ related node [[worker exploitation in electronics manufacturing]]

⥅ related node [[worker exploitation]]

⥅ related node [[worker self directed nonprofit]]

⥅ related node [[worker self organization]]

⥅ related node [[workers control]]

⥅ related node [[workflow for taking notes from podcasts]]

⥅ related node [[working class and green politics]]

⥅ related node [[working class history]]

⥅ related node [[working class voices season two with emma river roberts]]

⥅ related node [[working class voices]]

⥅ related node [[working class]]

⥅ related node [[working from near home]]

⥅ related node [[working offline]]

⥅ related node [[workplace democracy]]

⥅ related node [[world bank]]

⥅ related node [[world ecology]]

⥅ related node [[world economic forum]]

⥅ related node [[world land trust]]

⥅ related node [[world social forum]]

⥅ related node [[world systems theory]]

⥅ related node [[world trade organization]]

⥅ related node [[world war iii]]

⥅ related node [[world wide web]]

⥅ related node [[worlds largest direct air carbon capture system goes online]]

⥅ related node [[wp cli]]

⥅ related node [[writing a book]]

⥅ related node [[written history of hypertext]]

⥅ related node [[wrong version of python in org code blocks]]

⥅ related node [[wrongfully accused by an algorithm]]

⥅ related node [[xrandr configure crtc 0 failed problems]]

⥅ related node [[yanis varoufakis technofeudalism what killed capitalism]]

⥅ related node [[yanis varoufakis]]

⥅ related node [[yanis varoufakiss technofeudalism what killed capitalism]]

⥅ related node [[yanukovych]]

⥅ related node [[yemeni civil war]]

⥅ related node [[yemeni revolution]]

⥅ related node [[yes definitely]]

⥅ related node [[yorkshire dales]]

⥅ related node [[you shouldnt need permission to access your own files]]

⥅ related node [[your priorities]]

⥅ related node [[youtube dl]]

⥅ related node [[yunohost corrupted yaml read]]

⥅ related node [[yunohost invidious upgrade gives not enough free space]]

⥅ related node [[yunohost]]

⥅ related node [[yxm830]]

⥅ related node [[z library]]

⥅ related node [[zameen prapti sangharsh committee]]

⥅ related node [[zapatistas]]

⥅ related node [[zarah sultana]]

⥅ related node [[zebra]]

⥅ related node [[zebras fix what unicorns break]]

⥅ related node [[zebras unite]]

⥅ related node [[zero carbon cumbria]]

⥅ related node [[zero waste]]

⥅ related node [[zettelkasten and gtd]]

⥅ related node [[zeynep tufekci]]

⥅ related node [[zither]]

⥅ related node [[znc]]

⥅ related node [[zoonosis]]

⥅ related node [[zoonotic disease]]

⥅ related node [[zoopolis]]

⥅ related node [[2022 spring reading challenge]]

⥅ related node [[ernest hemingway]]

⥅ related node [[foam tips]]

⥅ related node [[paul auster]]

⥅ related node [[perseverance]]

⥅ related node [[the end of everything]]

⥅ related node [[medlock house]]

⥅ related node [[network of learning]]

⥅ related node [[turf durer]]

⥅ related node [[patterning resources]]

⥅ related node [[porch view]]

⥅ related node [[sullivan house]]

⥅ related node [[wurster hall]]

⥅ related node [[bernd & hilla becher_zeche hugo_gelsenkirchen_germany_1968]]

⥅ related node [[paul strand_croft_benbecula_hebrides_1954]]

⥅ related node [[continual command line crash course]]

⥅ related node [[demonstration of obsidian to github]]

⥅ related node [[digital garage]]

⥅ related node [[focus filters chalkboard and build log]]

⥅ related node [[focus filters]]

⥅ related node [[introducing focus filters and items]]

⥅ related node [[p go links]]

⥅ related node [[p grow a digital garden with chosen obsidian notes]]

⥅ related node [[plantey s digital garden]]

⥅ related node [[economía ambiental y de los recursos rurales]]

⥅ related node [[gestión y marco legal el recurso agua]]

⥅ related node [[17 62]]

⥅ related node [[abióticos]]

⥅ related node [[abreu gustavo]]

⥅ related node [[aliciardi maría belén]]

⥅ related node [[ambiente y coronavirus]]

⥅ related node [[ambiente]]

⥅ related node [[2020 04 14]]

⥅ related node [[2020 04 21]]

⥅ related node [[2020 04 08]]

⥅ related node [[artículo sobre covid 19 y ods]]

⥅ related node [[aspectos ambientales de las adquisiciones]]

⥅ related node [[aspectos para analizar en relación con el caso minamata]]

⥅ related node [[bienes comunes]]

⥅ related node [[bioética y bioeconomía]]

⥅ related node [[bioética]]

⥅ related node [[bióticos]]

⥅ related node [[cambio climático]]

⥅ related node [[ciclo biogeoquimico]]

⥅ related node [[clase de césar galarza]]

⥅ related node [[climate tipping points]]

⥅ related node [[compras públicas respetando el ambiente]]

⥅ related node [[compras públicas sustentables]]

⥅ related node [[comunicación y educación ambiental]]

⥅ related node [[concepciones de la naturaleza_y desarrollo en américa latina]]

⥅ related node [[conceptos sobre cifras de mérito en química analítica]]

⥅ related node [[consumo]]

⥅ related node [[cuestiones terminológicas i_ ambiente o medio ambiente_]]

⥅ related node [[cultura de la cancelación y lo que el viento se llevó]]

⥅ related node [[daniel seitune]]

⥅ related node [[de la economía del cowboy a la economía del astronauta]]

⥅ related node [[deforestación]]

⥅ related node [[derecho administrativo ambiental]]

⥅ related node [[derecho ambiental en tiempos de pandemia]]

⥅ related node [[derecho constitucional ambiental]]

⥅ related node [[derecho de moda]]

⥅ related node [[derecho penal ambiental]]

⥅ related node [[derecho procesal ambiental]]

⥅ related node [[derechos humanos]]

⥅ related node [[desarrollo sustentable o desarrollo sostenible]]

⥅ related node [[economia circular]]

⥅ related node [[edgardo ferré olive]]

⥅ related node [[el nuevo rembrandt]]

⥅ related node [[empleo verde]]

⥅ related node [[energías renovables]]

⥅ related node [[enfermedad de minamata]]

⥅ related node [[entrevista a peter singer en perfil com]]

⥅ related node [[europa 2021 2022]]

⥅ related node [[evaluación de impacto riesgo y remediación ambiental]]

⥅ related node [[fundamentos ecológicos y científicos clase 1]]

⥅ related node [[fundamentos filosóficos de la problemática ambiental]]

⥅ related node [[fundamentos filosóficos de la propiedad intelectual]]

⥅ related node [[garret hardin]]

⥅ related node [[gestión ambiental]]

⥅ related node [[gestión y marco legal de los residuos]]

⥅ related node [[gestión y marco legal el recurso aire]]

⥅ related node [[gestión y marco legal el recurso suelo]]

⥅ related node [[global environmental change and human security]]

⥅ related node [[global environmental change]]

⥅ related node [[gore al]]

⥅ related node [[gudynas eduardo]]

⥅ related node [[huella de carbono en la industria textil]]

⥅ related node [[huella ecológica]]

⥅ related node [[informe planeta vivo]]

⥅ related node [[ing maría angélica moya msc ]]

⥅ related node [[introducción a la cuestión ambiental clase 1]]

⥅ related node [[introducción a la cuestión ambiental]]

⥅ related node [[introducción a la educación ambiental]]

⥅ related node [[introducción al pensamiento complejo]]

⥅ related node [[jorge cabrera medaglia]]

⥅ related node [[jorge viñuales]]

⥅ related node [[la dama de parís]]

⥅ related node [[la historia de las cosas]]

⥅ related node [[la tragedia de los comunes]]

⥅ related node [[leonard annie]]

⥅ related node [[maestría en derecho]]

⥅ related node [[massachusetts v epa]]

⥅ related node [[2020 05 26]]

⥅ related node [[medio ambiente]]

⥅ related node [[metodología de la investigación]]

⥅ related node [[millenium farm assignment]]

⥅ related node [[minamata]]

⥅ related node [[objetivos de desarrollo sostenible en américa latina y el caribe]]

⥅ related node [[obsolescencia percibida]]

⥅ related node [[obsolescencia programada]]

⥅ related node [[oficina]]

⥅ related node [[pesca]]

⥅ related node [[peña chacón mario]]

⥅ related node [[política ambiental]]

⥅ related node [[política pública en hidrocarburos energía y minería]]

⥅ related node [[protocolo de nagoya]]

⥅ related node [[regulación ambiental internacional]]

⥅ related node [[responsabilidad por daño ambiental]]

⥅ related node [[responsabilidad social ambiental]]

⥅ related node [[2020)]]

⥅ related node [[richard baldwin]]

⥅ related node [[sumidero]]

⥅ related node [[supuestos gnoseológicos]]

⥅ related node [[think tanks]]

⥅ related node [[trófica]]

⥅ related node [[técnica feynman]]

⥅ related node [[uned derecho en españa]]

⥅ related node [[university of freiburg]]

⥅ related node [[zettelkasten method]]

⥅ related node [[¿existe una eco bioética o bioética ambiental_]]

⥅ related node [[20200604222651 lisp]]

⥅ related node [[20200604222704 functional_programming]]

⥅ related node [[20200607142247 political_economy]]

⥅ related node [[20200607211237 neoliberalism]]

⥅ related node [[20200607214217 colonialism]]

⥅ related node [[20200607220015 rosa_luxemburg]]

⥅ related node [[20200607220252 imperialism]]

⥅ related node [[20200607220504 china]]

⥅ related node [[20200607221838 althusser]]

⥅ related node [[20200607222010 feuerbach]]

⥅ related node [[20200607222051 praxis]]

⥅ related node [[20200611202011 marx]]

⥅ related node [[20200611203334 charles_dickens]]

⥅ related node [[20200611203450 charlotte_bronte]]

⥅ related node [[20200611203918 historical_materialism]]

⥅ related node [[20200611204104 engels]]

⥅ related node [[20200611204207 soviet_union]]

⥅ related node [[20200611204300 nicolai_mikhailovski]]

⥅ related node [[20200611205759 zapatista_army_of_national_liberation]]

⥅ related node [[20200611205921 mexico]]

⥅ related node [[20200611205930 nafta]]

⥅ related node [[20200616222015 vim]]

⥅ related node [[20200616223055 federal_reserve_of_the_united_states]]

⥅ related node [[20200616223725 quantitative_easing]]

⥅ related node [[20200616224953 volcker_shock]]

⥅ related node [[20200617220315 organic_composition_of_capital]]

⥅ related node [[20200617231712 tendency_for_the_rate_of_profit_to_fall]]

⥅ related node [[20200617233727 zettelkasten]]

⥅ related node [[20200621105741 komsomol]]

⥅ related node [[20200623222802 capitalist_crisis]]

⥅ related node [[20200623223058 malthus]]

⥅ related node [[20200625222115 george_floyd_protests]]

⥅ related node [[20200625222220 2019_hong_kong_protests]]

⥅ related node [[20200625222618 black_lives_matter]]

⥅ related node [[20200625223752 2019_chilean_protests]]

⥅ related node [[20200625224007 black_bloc]]

⥅ related node [[20200625230225 2014_ferguson_protests]]

⥅ related node [[20200628192919 jorge_borges]]

⥅ related node [[20200628193258 latin_american_literature]]

⥅ related node [[20200628212630 subjective_idealism]]

⥅ related node [[20200628212904 george_berkeley]]

⥅ related node [[20200628213016 materialism]]

⥅ related node [[20200628213059 idealism]]

⥅ related node [[20200628214434 magical_realism]]

⥅ related node [[20200628220742 nietzsche]]

⥅ related node [[20200628220903 bertrand_russell]]

⥅ related node [[20200629122112 international_monetary_fund]]

⥅ related node [[20200629122154 budget_deficit]]

⥅ related node [[20200629122347 2008_financial_crisis]]

⥅ related node [[20200629125826 modern_monetary_theory]]

⥅ related node [[20200629130431 keynesian_economics]]

⥅ related node [[20200629132801 nix]]

⥅ related node [[20200629132817 linux]]

⥅ related node [[20200629133954 nix_programming_language]]

⥅ related node [[20200629134018 nix_package_manager]]

⥅ related node [[20200629134051 nixos]]

⥅ related node [[20200629134132 unix]]

⥅ related node [[20200630214106 gnosticism]]

⥅ related node [[20200630223245 surrealism]]

⥅ related node [[20200704224607 roam]]

⥅ related node [[20200704225721 growth_mindset]]

⥅ related node [[20200705153811 fuzzing_computing]]

⥅ related node [[20200705154040 automated_testing]]

⥅ related node [[20200705154112 rust]]

⥅ related node [[20200706092404 rudolf_hilferding]]

⥅ related node [[20200706092416 social_democracy]]

⥅ related node [[20200706092434 monopoly_capital]]

⥅ related node [[20200706092530 german_social_democratic_party]]

⥅ related node [[20200706092541 karl_kautsky]]

⥅ related node [[20200706092621 vladimir_lenin]]

⥅ related node [[20200706092700 nikolai_bukharin]]

⥅ related node [[20200707090558 psychoanalysis]]

⥅ related node [[20200707090614 jacques_lacan]]

⥅ related node [[20200707090939 sigmund_freud]]

⥅ related node [[20200707091710 jouissance]]

⥅ related node [[20200707204901 political_party]]

⥅ related node [[20200707204913 organizing]]

⥅ related node [[20200707204946 alain_badiou]]

⥅ related node [[20200707205002 state_socialism]]

⥅ related node [[20200707205056 communism]]

⥅ related node [[20200707205243 bolsheviks]]

⥅ related node [[20200707205320 1917_october_revolution]]

⥅ related node [[20200707205429 proletkult]]

⥅ related node [[20200707205517 soviet_workers_council]]

⥅ related node [[20200707205547 cuba]]

⥅ related node [[20200707205638 cultural_revolution]]

⥅ related node [[20200707210224 mutual_aid]]

⥅ related node [[20200707210234 electoralism]]

⥅ related node [[20200708122521 cybernetics]]

⥅ related node [[20200708122541 type_theory]]

⥅ related node [[20200708122545 category_theory]]

⥅ related node [[20200708123521 cartesian_dualism]]

⥅ related node [[20200708123759 clojure]]

⥅ related node [[20200708123930 haskell]]

⥅ related node [[20200708123936 standard_ml]]

⥅ related node [[20200709205051 decolonization]]

⥅ related node [[20200709205144 abraham_lincolon]]

⥅ related node [[20200709205236 united_states_civil_war]]

⥅ related node [[20200709205258 w_e_b_du_bois]]

⥅ related node [[20200709205838 westphalia_model_of_nation_states]]

⥅ related node [[20200709231258 emacs]]

⥅ related node [[20200709231653 go_programming_language]]

⥅ related node [[20200709233224 c_programming_language]]

⥅ related node [[20200709233739 writing_emacs_modules]]

⥅ related node [[20200711011029 luhmann]]

⥅ related node [[20200711012007 abstract]]

⥅ related node [[20200711012441 survivorship_bias]]

⥅ related node [[20200711013059 literature_notes]]

⥅ related node [[20200712110047 zettelkasten_note_taking_process]]

⥅ related node [[20200712110330 tools]]

⥅ related node [[20200712231841 judaism]]

⥅ related node [[20200713095640 politics]]

⥅ related node [[20200713095729 nation_state]]

⥅ related node [[20200713095751 nationalism]]

⥅ related node [[20200713095831 18th_brumaire_of_louis_napoleon]]

⥅ related node [[20200713100000 stalinism]]

⥅ related node [[20200713100017 right_wing]]

⥅ related node [[20200713100151 revolution]]

⥅ related node [[20200713102420 religion]]

⥅ related node [[20200713102437 capitalism_as_religion]]

⥅ related node [[20200713102526 catholic_church]]

⥅ related node [[20200713102536 protestantism]]

⥅ related node [[20200713102917 modernity]]

⥅ related node [[20200713103540 emacs_lisp]]

⥅ related node [[20200713205102 max_weber]]

⥅ related node [[20200713205249 the_commons]]

⥅ related node [[20200713205316 middle_ages]]

⥅ related node [[20200713205411 capitalist_ideology]]

⥅ related node [[20200713205428 private_property]]

⥅ related node [[20200713212425 nazis]]

⥅ related node [[20200713215924 judas]]

⥅ related node [[20200713215950 jesus_christ]]

⥅ related node [[20200714093206 holy_inquisition]]

⥅ related node [[20200714093221 heresy]]

⥅ related node [[20200714093257 spanish_inquisition]]

⥅ related node [[20200714093453 prosperity_theology]]

⥅ related node [[20200714093709 john_locke]]

⥅ related node [[20200714093742 john_milton]]

⥅ related node [[20200714093826 diggers]]

⥅ related node [[20200714093903 enclosure_of_the_commons]]

⥅ related node [[20200714101023 gerrard_winstanley]]

⥅ related node [[20200714104617 opiate_of_the_masses]]

⥅ related node [[20200716124423 commodity]]

⥅ related node [[20200716124455 use_value]]

⥅ related node [[20200716124539 exchange_value]]

⥅ related node [[20200716124615 abstract_labor]]

⥅ related node [[20200716124643 socially_necessary_labor_time]]

⥅ related node [[20200716124833 labor]]

⥅ related node [[20200716124919 division_of_labor]]

⥅ related node [[20200716125039 concrete_labor]]

⥅ related node [[20200716125140 money]]

⥅ related node [[20200716125213 commodity_fetishism]]

⥅ related node [[20200716134257 surplus_value]]

⥅ related node [[20200716134328 capitalist]]

⥅ related node [[20200716134537 c_m_c_exchange]]

⥅ related node [[20200716134542 m_c_m_exchange]]

⥅ related node [[20200716134715 the_general_formula_of_the_circulation_of_capital]]

⥅ related node [[20200716135348 labor_power]]

⥅ related node [[20200716135419 proletariat]]

⥅ related node [[20200716135507 free_labor]]

⥅ related node [[20200716140035 means_of_production]]

⥅ related node [[20200716140724 alienation]]

⥅ related node [[20200716141014 slavery]]

⥅ related node [[20200716141042 valorization]]

⥅ related node [[20200716142057 constant_capital]]

⥅ related node [[20200716142107 variable_capital]]

⥅ related node [[20200716142405 necessary_labor_time]]

⥅ related node [[20200716142442 mode_of_production]]

⥅ related node [[20200716142632 surplus_product]]

⥅ related node [[20200716142649 working_day]]

⥅ related node [[20200716142845 surplus_labor]]

⥅ related node [[20200716142900 rate_of_surplus_value]]

⥅ related node [[20200716144521 absolute_surplus_value]]

⥅ related node [[20200716144529 relative_surplus_value]]

⥅ related node [[20200716144936 wage_labor]]

⥅ related node [[20200716145003 manufacturing]]

⥅ related node [[20200716145508 john_stuart_mill]]

⥅ related node [[20200716145612 machinery]]

⥅ related node [[20200716145740 wages]]

⥅ related node [[20200718223520 scheme]]

⥅ related node [[20200720093911 ecology]]

⥅ related node [[20200720094032 developmentalism]]

⥅ related node [[20200720095122 proudhon]]

⥅ related node [[20200720095202 prometheus]]

⥅ related node [[20200720095234 teleology]]

⥅ related node [[20200720100044 epicurus]]

⥅ related node [[20200720100117 hegel]]

⥅ related node [[20200720100506 french_revolution]]

⥅ related node [[20200720100600 darwin]]

⥅ related node [[20200720100618 theory_of_evolution]]

⥅ related node [[20200720100629 co_operation]]

⥅ related node [[20200720100714 class_struggle]]

⥅ related node [[20200720100806 natural_selection]]

⥅ related node [[20200720100856 metabolic_rift]]

⥅ related node [[20200720132835 javascript]]

⥅ related node [[20200720152135 systems_theory]]

⥅ related node [[20200720152428 feedback]]

⥅ related node [[20200720200955 philosophy]]

⥅ related node [[20200720201313 alexander_bogdanov]]

⥅ related node [[20200720201422 nature]]

⥅ related node [[20200720202354 ideology]]

⥅ related node [[20200720203254 democrtius]]

⥅ related node [[20200720221509 ernst_mach]]

⥅ related node [[20200720224009 theses_on_feuerbach]]

⥅ related node [[20200720224232 aristotle]]

⥅ related node [[20200720224446 isaac_newton]]

⥅ related node [[20200720225541 monism]]

⥅ related node [[20200721210202 history_of_philosophy]]

⥅ related node [[20200721210255 science]]

⥅ related node [[20200721210619 thales]]

⥅ related node [[20200721210901 anaximander]]

⥅ related node [[20200721211314 anaximenes]]

⥅ related node [[20200721212226 anaxagoras]]

⥅ related node [[20200721212908 leibniz]]

⥅ related node [[20200721215556 empedocles]]

⥅ related node [[20200721223147 sensualism]]

⥅ related node [[20200721223720 solipsism]]

⥅ related node [[20200721223746 abstract_fetishism]]

⥅ related node [[20200721224050 protagoras]]

⥅ related node [[20200722210010 the_german_ideology]]

⥅ related node [[20200723204621 the_holy_family]]

⥅ related node [[20200723204958 bruno_bauer]]

⥅ related node [[20200723210039 spinoza]]

⥅ related node [[20200723211029 guizot]]

⥅ related node [[20200723211050 france]]

⥅ related node [[20200723211102 prussia]]

⥅ related node [[20200723211634 the_condition_of_the_working_class_in_england]]

⥅ related node [[20200723212137 max_stirner]]

⥅ related node [[20200723212214 young_hegelians]]

⥅ related node [[20200723212356 england]]

⥅ related node [[20200727223821 roman_empire]]

⥅ related node [[20200727224212 renaissance]]

⥅ related node [[20200727224630 francis_bacon]]

⥅ related node [[20200727225533 scholasticism]]

⥅ related node [[20200727225630 empiricism]]

⥅ related node [[20200728232815 thomas_hobbes]]

⥅ related node [[20200728234350 david_hume]]

⥅ related node [[20200728234943 skepticism]]

⥅ related node [[20200729124219 absolute_monarchy]]

⥅ related node [[20200804203239 richard_avenarius]]

⥅ related node [[20200804204051 empiriocriticism]]

⥅ related node [[20200809194526 the_poverty_of_philosophy]]

⥅ related node [[20200809200624 principles_of_communism]]

⥅ related node [[20200809200639 communist_manifesto]]

⥅ related node [[20200810223554 plato]]

⥅ related node [[20200810223639 dialectical_materialism]]

⥅ related node [[20200810223959 heraclitus_the_obscure]]

⥅ related node [[20200810225100 zarathustra]]

⥅ related node [[20200810225409 fitche]]

⥅ related node [[20200810225417 schelling]]

⥅ related node [[20200817220931 anti_duhring]]

⥅ related node [[20200817221335 joseph_dietzgen]]

⥅ related node [[20200824222403 sartre]]

⥅ related node [[20200913222320 immanuel_kant]]

⥅ related node [[20200920170321 promethean_struggle]]

⥅ related node [[20200920174834 darwin_s_ideas_are_a_product_of_his_time]]

⥅ related node [[20200928232213 critical_confusion]]

⥅ related node [[20200928232313 critical_theory]]

⥅ related node [[20200928232323 frankfurt_school]]

⥅ related node [[20201004164103 daily]]

⥅ related node [[20201005215722 thomas_hariot]]

⥅ related node [[20201005220012 pierre_gassendi]]

⥅ related node [[20201005220024 rene_descartes]]

⥅ related node [[20201005220322 john_evelyn]]

⥅ related node [[20201005220336 charles_i]]

⥅ related node [[20201005220341 charles_ii]]

⥅ related node [[20201005220500 royal_society]]

⥅ related node [[20201005221109 aristotelian_thought]]

⥅ related node [[20201005221450 voltaire]]

⥅ related node [[20201005221506 lucretius]]

⥅ related node [[20201014224056 circuit_of_capital]]

⥅ related node [[20201014230245 wages]]

⥅ related node [[20201020153727 socialism_must_be_global]]

⥅ related node [[20201020153750 stalin]]

⥅ related node [[20201020153758 socialism_in_one_country]]

⥅ related node [[20201028093457 autopoiesis]]

⥅ related node [[20201028095318 system]]

⥅ related node [[20201028095350 stafford_beer]]

⥅ related node [[20201028140048 ordoliberalism]]

⥅ related node [[20201028140123 ronald_reagan]]

⥅ related node [[20201028140135 margret_thatcher]]

⥅ related node [[20201101122329 critique_of_the_gotha_programme]]

⥅ related node [[20201111222005 capital]]

⥅ related node [[20201117202829 capital_only_acquires_value_in_its_movement]]

⥅ related node [[20201117204051 supply_and_demand]]

⥅ related node [[20201117204827 production_time]]

⥅ related node [[20201117205705 productivity_of_capital]]

⥅ related node [[20201129135812 primitive_accumulation]]

⥅ related node [[20201129140059 adam_smith]]

⥅ related node [[20201129150458 marx_s_theory_of_surplus_value]]

⥅ related node [[20201129151756 factions_of_capital]]

⥅ related node [[20201129151900 industrial_capital]]

⥅ related node [[20201202215354 us_economy_during_the_covid_pandemic]]

⥅ related node [[20201202215710 covid_19]]

⥅ related node [[20201210164227 fears_are_hidden_desires]]

⥅ related node [[20201212163538 circulation_of_capital]]

⥅ related node [[20201212163826 commodity_capital]]

⥅ related node [[20201212163902 money_capital]]

⥅ related node [[20201212163941 productive_capital]]

⥅ related node [[20201212165432 transportation_develops_as_its_own_branch_of_production]]

⥅ related node [[20201212165832 turnover_time_of_capital]]

⥅ related node [[20201212170646 the_role_of_machines_in_marx_s_political_economy]]

⥅ related node [[20201212171512 fixed_capital]]

⥅ related node [[20201212171706 fluid_capital]]

⥅ related node [[20201219144156 dual_power]]

⥅ related node [[20201219144610 likelihood_of_revolution]]

⥅ related node [[20201219144938 capitalism_has_eliminated_the_hungry_mob]]

⥅ related node [[20201219145138 second_world_war]]

⥅ related node [[20201219145217 living_standards]]

⥅ related node [[20201219145415 ancien_regime]]

⥅ related node [[20201219145837 workerism]]

⥅ related node [[20201219145900 law]]

⥅ related node [[20201219150337 identity]]

⥅ related node [[20201219150348 cinema]]

⥅ related node [[20201219150451 nazi_cinema]]

⥅ related node [[20201219162423 marx_s_criticism_of_adam_smith]]

⥅ related node [[20201229155002 worker_peasant_alliance]]

⥅ related node [[20201230142320 capitalism_and_greed]]

⥅ related node [[20201230142523 capitalism_and_debt]]

⥅ related node [[20201230142537 debt]]

⥅ related node [[20201230142542 credit]]

⥅ related node [[20201230142705 austerity]]

⥅ related node [[20201230142746 not_all_capital_is_money]]

⥅ related node [[20210103203659 technology]]

⥅ related node [[20210103203710 tech_criticism]]

⥅ related node [[20210103204046 data_is_not_neutral]]

⥅ related node [[20210103204054 big_data]]

⥅ related node [[20210103204151 living_experience]]

⥅ related node [[20210103204755 technology_in_capitalism]]

⥅ related node [[20210103204922 social_problems_do_not_have_technical_solutions]]

⥅ related node [[20210103205104 technocracy]]

⥅ related node [[20210103205314 cryptocurrency]]

⥅ related node [[20210103205430 libertarianism]]

⥅ related node [[20210103210847 central_banking]]

⥅ related node [[20210103211116 liberalism]]

⥅ related node [[20210103211518 fiat_currency]]

⥅ related node [[20210103211547 gold_standard]]

⥅ related node [[20210103211954 populism]]

⥅ related node [[20210106124542 revolution_is_downstream_of_economics]]

⥅ related node [[20210106124551 nature_of_revolution]]

⥅ related node [[20210106124940 capitalism_imposes_constraints_on_social_behavior]]

⥅ related node [[20210111112524 tech_organizing]]

⥅ related node [[20210111121611 covid_crash]]

⥅ related node [[20210114144435 kautsky_was_right_about_imperialism_in_the_long_term]]

⥅ related node [[20210116154952 category]]

⥅ related node [[20210116180302 reserve_army_of_labor]]

⥅ related node [[20210117142702 relations]]

⥅ related node [[20210117142752 morphism]]

⥅ related node [[20210117143856 function]]

⥅ related node [[20210117151327 endorelation]]

⥅ related node [[20210118212004 commodity_money]]

⥅ related node [[20210118212122 currency_sovereignty]]

⥅ related node [[20210118212432 there_s_no_such_thing_as_barter]]

⥅ related node [[20210118224326 law_as_a_tool_of_class_conflict]]

⥅ related node [[20210118224640 capitalism_could_have_started_in_the_roman_empire]]

⥅ related node [[20210118224800 feudalism]]

⥅ related node [[20210120215019 economic_planning]]

⥅ related node [[20210120215050 post_capitalist_economics]]

⥅ related node [[20210120220708 calculation_problem]]

⥅ related node [[20210120220847 ludwig_von_mises]]

⥅ related node [[20210120222224 friedrich_hayek]]

⥅ related node [[20210120222618 otto_neurath]]

⥅ related node [[20210120225414 problems_of_digital_socialist_planning]]

⥅ related node [[20210120225816 socialist_planning]]

⥅ related node [[20210120230148 gosplan]]

⥅ related node [[20210120230250 cybersyn]]

⥅ related node [[20210120230304 market_socialism]]

⥅ related node [[20210123161721 simple_reproduction]]

⥅ related node [[20210123162353 expanded_reproduction]]

⥅ related node [[20210123163257 marx_s_theroy_of_value_is_a_monetary_one]]

⥅ related node [[20210123163312 value]]

⥅ related node [[20210123185417 capital_controls_the_social_intellect]]

⥅ related node [[20210123185428 general_intellect]]

⥅ related node [[20210123185752 can_science_and_technology_be_separated_from_capitalism]]

⥅ related node [[20210123185808 science_in_capitalism]]

⥅ related node [[20210124202141 satanic_inverse]]

⥅ related node [[20210124202830 anti_americanism]]

⥅ related node [[20210124202852 american_exceptionalism]]

⥅ related node [[20210124203024 anti_imperialism]]

⥅ related node [[20210127223151 physiocracy]]

⥅ related node [[20210127223303 agriculture]]

⥅ related node [[20210127223322 enlightenment]]

⥅ related node [[20210130181121 wages_are_determined_by_the_cost_of_the_reproduction_of]]

⥅ related node [[20210130181335 workers_only_have_their_labor_power_to_sell]]

⥅ related node [[20210130181427 workers]]

⥅ related node [[20210130181502 means_of_subsistence]]

⥅ related node [[20210130191322 germany]]

⥅ related node [[20210130191438 history_of_socialism]]

⥅ related node [[20210131223857 revolutions_of_1848]]

⥅ related node [[20210131224149 german_unification]]

⥅ related node [[20210131224458 stephan_born]]

⥅ related node [[20210131225724 class_consciousness]]

⥅ related node [[20210131230029 general_german_workers_association]]

⥅ related node [[20210131230108 ferdinand_lassalle]]

⥅ related node [[20210131230124 heinrich_heine]]

⥅ related node [[20210131230821 jacobins]]

⥅ related node [[20210131230928 napoleon_iii]]

⥅ related node [[20210131230959 bismarck]]

⥅ related node [[20210204085035 lisp_machine]]

⥅ related node [[20210204085053 operating_systems]]

⥅ related node [[20210204095729 how_should_socialists_measure_success]]

⥅ related node [[20210204095739 socialism]]

⥅ related node [[20210204100241 the_collapse_of_the_soviet_union]]

⥅ related node [[20210204100302 cuban_revolution]]

⥅ related node [[20210204100341 the_communist_horizon]]

⥅ related node [[20210204100833 american_revolution]]

⥅ related node [[20210204100918 the_civil_rights_act]]

⥅ related node [[20210204100931 women_s_sufferage_in_the_united_states]]

⥅ related node [[20210204101000 abolition_of_slavery_in_the_untied_states]]

⥅ related node [[20210204223826 august_bebel]]

⥅ related node [[20210204223936 wilhelm_liebknecht]]

⥅ related node [[20210204223950 first_international]]

⥅ related node [[20210204224215 trade_unions]]

⥅ related node [[20210204224405 german_reichstag]]

⥅ related node [[20210204230921 german_empire]]

⥅ related node [[20210206074318 franco_prussian_war]]

⥅ related node [[20210206104803 ayn_rand_s_philosophy_is_tautological]]

⥅ related node [[20210206104808 ayn_rand]]

⥅ related node [[20210206104815 objectivism]]

⥅ related node [[20210206111825 one_reactionary_mass]]

⥅ related node [[20210206113011 kaiser_wilhelm_i]]

⥅ related node [[20210206115258 eduard_bernstein]]

⥅ related node [[20210206143514 hottentot_election]]

⥅ related node [[20210206151537 paul_singer]]

⥅ related node [[20210206153910 karl_liebknecht]]

⥅ related node [[20210210215405 example_of_fixed_capital_cooking]]

⥅ related node [[20210211094530 productivity_paradox]]

⥅ related node [[20210211094543 automation]]

⥅ related node [[20210218215304 economics]]

⥅ related node [[20210228124738 guilds]]

⥅ related node [[20210228125302 iron_law_of_wages]]

⥅ related node [[20210228134207 carl_legien]]

⥅ related node [[20210228134239 samuel_gompers]]

⥅ related node [[20210228135229 mass_strike]]

⥅ related node [[20210228135352 second_international]]

⥅ related node [[20210228135444 1905_russian_revolution]]

⥅ related node [[20210228142031 the_role_of_trade_unions_in_the_transition_to_socialism]]

⥅ related node [[20210228142145 syndicalism]]

⥅ related node [[20210228142516 bureaucracy]]

⥅ related node [[20210228142531 role_of_bureaucracy_within_organizations]]

⥅ related node [[20210302134420 republicanism]]

⥅ related node [[20210302140300 french_third_republic]]

⥅ related node [[20210302141441 direct_democracy]]

⥅ related node [[20210302144830 labor_party]]

⥅ related node [[20210302145531 early_socialists_and_advocating_repblicanism]]

⥅ related node [[20210302145547 democracy]]

⥅ related node [[20210302145713 second_reich]]

⥅ related node [[20210306160859 artificial_intelligence]]

⥅ related node [[20210306161251 universal_basic_income]]

⥅ related node [[20210306161654 fully_automated_luxury_communism]]

⥅ related node [[20210306163324 utopian_socialism]]

⥅ related node [[20210306163746 post_scarcity]]

⥅ related node [[20210306164444 service_sector]]

⥅ related node [[20210306164610 deindustrialization]]

⥅ related node [[20210306171918 centralization_of_capital]]

⥅ related node [[20210306171957 globalization]]

⥅ related node [[20210306172719 overcapacity_led_to_deindustrialization]]

⥅ related node [[20210306172935 post_war_era_in_the_us]]

⥅ related node [[20210307152738 programming_languages]]

⥅ related node [[20210307153354 s_expression]]

⥅ related node [[20210307153455 programming]]

⥅ related node [[20210307153537 abstract_syntax_tree]]

⥅ related node [[20210307153829 linked_list]]

⥅ related node [[20210307165050 racket]]

⥅ related node [[20210307170643 dialect_of_lisp]]

⥅ related node [[20210309214442 singularity]]

⥅ related node [[20210310111947 labor_theory_of_value]]

⥅ related node [[20210310112141 exploitation]]

⥅ related node [[20210310112616 philosophy_of_science]]

⥅ related node [[20210310113839 dialectics]]

⥅ related node [[20210310142248 technological_progress_is_not_linear]]

⥅ related node [[20210310142255 progress]]

⥅ related node [[20210310142412 industrial_revolution]]

⥅ related node [[20210310144658 linear_progress]]

⥅ related node [[20210310144711 technological_development]]

⥅ related node [[20210310164325 reinvestment_and_labor_market_are_unique_to_capitalism]]

⥅ related node [[20210310164612 capitalists_do_not_horde_their_money]]

⥅ related node [[20210310164827 bourgeoisie]]

⥅ related node [[20210310164831 class]]

⥅ related node [[20210310165131 peasantry]]

⥅ related node [[20210310212707 general_law_of_capitalist_accumulation]]

⥅ related node [[20210311213119 actor_model]]

⥅ related node [[20210311213140 programming_paradigms]]

⥅ related node [[20210311213212 object_oriented_programming]]

⥅ related node [[20210311213613 erlang]]

⥅ related node [[20210312162123 lisp_programs_are_also_data]]

⥅ related node [[20210312164354 capital_strike]]

⥅ related node [[20210312164713 new_deal]]

⥅ related node [[20210312164831 public_spending_cannot_fight_capital]]

⥅ related node [[20210312164849 fiscal_policy]]

⥅ related node [[20210312164855 role_of_government]]

⥅ related node [[20210312165519 thomas_paine]]

⥅ related node [[20210312165716 milton_friedman]]

⥅ related node [[20210312170133 silicon_valley]]

⥅ related node [[20210312170148 public_welfare]]

⥅ related node [[20210312174704 tcl]]

⥅ related node [[20210312175623 there_is_no_alternative]]

⥅ related node [[20210312175831 eternal_present]]

⥅ related node [[20210312180305 etienne_cabet]]

⥅ related node [[20210313162926 annihilation_of_space_by_time]]

⥅ related node [[20210313163737 movement_of_capital]]

⥅ related node [[20210313165346 sublation]]

⥅ related node [[20210313165617 beauty]]

⥅ related node [[20210313165726 the_purpose_of_a_system_is_what_it_does]]

⥅ related node [[20210313170227 marx_s_analysis_in_capital_vol_1_is_posiwid]]

⥅ related node [[20210314121301 functional_application]]

⥅ related node [[20210314131132 using_box_to_represent_closures_in_rust]]

⥅ related node [[20210314131218 dial]]

⥅ related node [[20210316133014 dialectics_is_not_about_defining_terms_but_creating_terms]]

⥅ related node [[20210318163632 money_is_a_tool_to_avoid_having_a_social_relation]]

⥅ related node [[20210318213337 consumer_economy]]

⥅ related node [[20210318213618 input_output_tables]]

⥅ related node [[20210318213708 central_planning]]

⥅ related node [[20210318220316 laissez_faire]]

⥅ related node [[20210318220833 marx_was_an_early_systems_theorist]]

⥅ related node [[20210321183219 kronstadt_rebellion]]

⥅ related node [[20210321201247 the_accumulation_of_capital]]

⥅ related node [[20210321201813 capitalism_is_totalizing]]

⥅ related node [[20210321201949 behavior_of_capitalism]]

⥅ related node [[20210321202756 tragedy_of_the_commons]]

⥅ related node [[20210321205327 the_commodification_of_data]]

⥅ related node [[20210321210900 surveillance_capitalism]]

⥅ related node [[20210321211404 techno_libertarianism]]

⥅ related node [[20210326181725 software_should_be_built_for_humans]]

⥅ related node [[20210326181738 software_design]]

⥅ related node [[20210326182908 techno_utopianism]]

⥅ related node [[20210326182932 nettime]]

⥅ related node [[20210328130312 clara_zetkin]]

⥅ related node [[20210330201448 problem_of_representation]]

⥅ related node [[20210330201641 united_states]]

⥅ related node [[20210330201741 electoral_college]]

⥅ related node [[20210330202208 peasant_question]]

⥅ related node [[20210330202254 centralization_vs_decentralization_is_a_false_dichotomy]]

⥅ related node [[20210403130020 implementing_lisp_scope_and_closure]]

⥅ related node [[20210403130721 dial_implementation]]

⥅ related node [[20210403142357 labor_aristocracy]]

⥅ related node [[20210403143428 is_china_imperialist]]

⥅ related node [[20210403151224 racial_capitalism]]

⥅ related node [[20210403151238 race]]

⥅ related node [[20210404104508 lisp_primitives]]

⥅ related node [[20210405165253 luddites]]

⥅ related node [[20210405165910 technology_is_not_neutral]]

⥅ related node [[20210405170854 samir_amin]]

⥅ related node [[20210407163530 λ_calculus]]

⥅ related node [[20210407163538 mathematics]]

⥅ related node [[20210407163715 computer_science]]

⥅ related node [[20210411214202 jit_compilation]]

⥅ related node [[20210411214209 compilers]]

⥅ related node [[20210411214221 programming_language_implementation]]

⥅ related node [[20210417104136 communist_organizations_are_subsets_of_organizations]]

⥅ related node [[20210417104205 organizations]]

⥅ related node [[20210417104224 communist_party]]

⥅ related node [[20210417104342 cult_of_personality]]

⥅ related node [[20210417114754 fordism]]

⥅ related node [[20210417115908 finance_capital]]

⥅ related node [[20210418172543 identities_are_commodified_by_capitalism]]

⥅ related node [[20210418172555 commodification]]

⥅ related node [[20210418172919 punk]]

⥅ related node [[20210418172939 lgbt_movement]]

⥅ related node [[20210418173207 rainbow_capitalism]]

⥅ related node [[20210419110651 confederados]]

⥅ related node [[20210419112422 confederate_states_of_america]]

⥅ related node [[20210419112435 brazil]]

⥅ related node [[20210419211549 universal_sufferage]]

⥅ related node [[20210419212237 eugen_duhring]]

⥅ related node [[20210419215114 revisionism]]

⥅ related node [[20210420155756 one_is_not_born_a_woman]]

⥅ related node [[20210420161900 property_testing]]

⥅ related node [[20210420161958 python]]

⥅ related node [[20210420173545 bash]]

⥅ related node [[20210421095326 christianity]]

⥅ related node [[20210421095355 slavoj_zizek]]

⥅ related node [[20210421103750 judith_butler]]

⥅ related node [[20210421104341 joan_copjec]]

⥅ related node [[20210421142717 sokal_affair]]

⥅ related node [[20210421155432 consciousness]]

⥅ related node [[20210421155446 film_theory]]

⥅ related node [[20210421170057 second_wave_feminism]]

⥅ related node [[20210421170354 phallus]]

⥅ related node [[20210421170402 castration]]

⥅ related node [[20210422101309 carl_jung]]

⥅ related node [[20210422202415 reformism]]

⥅ related node [[20210423133247 type_driven_development]]

⥅ related node [[20210423133319 type_programming]]

⥅ related node [[20210423171911 concurrent_programming]]

⥅ related node [[20210424180548 first_world_war]]

⥅ related node [[20210424180601 internationalism]]

⥅ related node [[20210425112037 reform_vs_revolution]]

⥅ related node [[20210425113734 vanguard_party]]

⥅ related node [[20210425124457 activation_record]]

⥅ related node [[20210425124511 stack_memory]]

⥅ related node [[20210425135143 dial_interpreter_third_implementation]]

⥅ related node [[20210426153423 class_in_itself]]

⥅ related node [[20210426153429 class_for_itself]]

⥅ related node [[20210426154542 ngo]]

⥅ related node [[20210427204037 climate_change]]

⥅ related node [[20210428141801 tiananmen_square_protests]]

⥅ related node [[20210428155753 chongqing_model]]

⥅ related node [[20210428155930 mao_zedong]]

⥅ related node [[20210428160734 chinese_new_left]]

⥅ related node [[20210429094903 parry_language_design]]

⥅ related node [[20210429100228 a_party_should_have_proprietary_social_media]]

⥅ related node [[20210429105507 my_programming_languages]]

⥅ related node [[20210429133404 language_design]]

⥅ related node [[20210429134011 use_of_irony_is_a_means_of_coping_with_trauma]]

⥅ related node [[20210429134158 trauma]]

⥅ related node [[20210429134317 continuation]]

⥅ related node [[20210429152530 revolution_is_a_social_necessity]]

⥅ related node [[20210503135803 kroz_language_design]]

⥅ related node [[20210503150518 implementing_languages_in_racket]]

⥅ related node [[20210506153419 may_1968]]

⥅ related node [[20210506160413 desire]]

⥅ related node [[20210506160735 oedipus_complex]]

⥅ related node [[20210506162841 deleuze]]

⥅ related node [[20210506162847 guattari]]

⥅ related node [[20210506164244 mid_atlantic_accent]]

⥅ related node [[20210506164319 fdr]]

⥅ related node [[20210506164324 cary_grant]]

⥅ related node [[20210506164404 hollywood]]

⥅ related node [[20210506164814 rhizome]]

⥅ related node [[20210507122748 for_loops_considered_harmful]]

⥅ related node [[20210509115409 many_nazis_held_positions_of_power_in_west_germany]]

⥅ related node [[20210509115420 west_germany]]

⥅ related node [[20210509115637 operation_paperclip]]

⥅ related node [[20210509122342 fascism]]

⥅ related node [[20210509131706 drive_theory]]

⥅ related node [[20210509173219 leon_trotsky]]

⥅ related node [[20210509173514 spartakus_league]]

⥅ related node [[20210509211547 german_revolution]]

⥅ related node [[20210510113237 theory_of_relativity]]

⥅ related node [[20210511101412 sergei_eisenstein]]

⥅ related node [[20210511101702 charlie_chaplin]]

⥅ related node [[20210511215432 hitler]]

⥅ related node [[20210511215745 red_guard]]

⥅ related node [[20210511215939 freikorps]]

⥅ related node [[20210511220638 kpd]]

⥅ related node [[20210516164014 parse_don_t_validate]]

⥅ related node [[20210516164106 static_type_systems]]

⥅ related node [[20210516164317 partial_function]]

⥅ related node [[20210516164934 parser]]

⥅ related node [[20210516170023 shotgun_parsing]]

⥅ related node [[20210516170032 antipattern]]

⥅ related node [[20210516170353 data_type]]

⥅ related node [[20210516170826 characteristics_of_good_software_design]]

⥅ related node [[20210516170837 software_maintainability]]

⥅ related node [[20210516171925 windows]]

⥅ related node [[20210516172326 magnus_hirschfeld]]

⥅ related node [[20210516172502 institut_fur_sexualwissenschaft]]

⥅ related node [[20210516172631 gender]]

⥅ related node [[20210516172638 sexuality]]

⥅ related node [[20210516173327 lexical_analysis]]

⥅ related node [[20210516173347 lexer]]

⥅ related node [[20210516174118 context_free_grammar]]

⥅ related node [[20210516180147 friedrich_ebert]]

⥅ related node [[20210516180928 independent_social_democratic_party]]

⥅ related node [[20210516181104 spartakist_uprising]]

⥅ related node [[20210517170559 revolutionaries_have_an_obligation_to_destroy_tech]]

⥅ related node [[20210518131807 project_urbs]]

⥅ related node [[20210518131815 my_projects]]

⥅ related node [[20210518213004 the_end_of_history]]

⥅ related node [[20210518213042 contradiction]]

⥅ related node [[20210518213112 contradiction_is_eternal]]

⥅ related node [[20210518213540 law_of_identity]]

⥅ related node [[20210518214342 reason]]

⥅ related node [[20210518215229 haskell_like_types]]

⥅ related node [[20210518215236 c_like_types]]

⥅ related node [[20210518220053 freedom]]

⥅ related node [[20210519104116 tumblr]]

⥅ related node [[20210519104136 hypercard]]

⥅ related node [[20210519135344 apple]]

⥅ related node [[20210519135414 hypermedia]]

⥅ related node [[20210520101217 deep_state]]

⥅ related node [[20210520104349 right_hegelians]]

⥅ related node [[20210520105015 unconsciousness]]

⥅ related node [[20210520113302 left_wing]]

⥅ related node [[20210520113610 self_betrayal]]

⥅ related node [[20210520120017 right_left_divide]]

⥅ related node [[20210520131557 urbstalk]]

⥅ related node [[20210520131752 hypertalk]]

⥅ related node [[20210520132129 the_crusifiction]]

⥅ related node [[20210520132206 jesus_christ_as_a_representation_of_god]]

⥅ related node [[20210520132227 death_of_god]]

⥅ related node [[20210520163222 foucault]]

⥅ related node [[20210520163227 adorno]]

⥅ related node [[20210520201930 bremen_soviet_republic]]

⥅ related node [[20210521102127 alan_kay_on_lisp]]

⥅ related node [[20210521102135 alan_kay]]

⥅ related node [[20210521132503 smalltalk]]

⥅ related node [[20210521132658 java]]

⥅ related node [[20210521132709 inheritence]]

⥅ related node [[20210521211446 c]]

⥅ related node [[20210521211455 c]]

⥅ related node [[20210521211550 class_programming]]

⥅ related node [[20210521211631 free_function]]

⥅ related node [[20210521211721 function_programming]]

⥅ related node [[20210521211757 method_programming]]

⥅ related node [[20210522185858 anarchism]]

⥅ related node [[20210522185957 transition_period]]

⥅ related node [[20210522190031 transition_to_communism]]

⥅ related node [[20210522190308 is_the_transition_to_communism_necessary]]

⥅ related node [[20210522190746 power]]

⥅ related node [[20210522191516 synthetic_a_priori]]

⥅ related node [[20210522191727 judgment]]

⥅ related node [[20210522191822 analytic_judgment]]

⥅ related node [[20210522191828 synthetic_judgment]]

⥅ related node [[20210523162513 slums]]

⥅ related node [[20210523163059 philanthropy]]

⥅ related node [[20210523163133 poverty]]

⥅ related node [[20210523163347 abolition_of_the_proletariat]]

⥅ related node [[20210523164823 orthodox_marxism]]

⥅ related node [[20210523165239 should_workers_run_for_office]]

⥅ related node [[20210523165611 state_as_a_tool_of_class_struggle]]

⥅ related node [[20210525105654 is_longevity_a_drain_on_a_society]]

⥅ related node [[20210525105730 longevity]]

⥅ related node [[20210525202211 nix_flakes]]

⥅ related node [[20210526120310 truth]]

⥅ related node [[20210526120421 sophistry]]

⥅ related node [[20210526125354 sense_certainty]]

⥅ related node [[20210526125443 conspiracy_thinking]]

⥅ related node [[20210526153610 subject_object_divide]]

⥅ related node [[20210526153722 objet_a]]

⥅ related node [[20210526163902 the_question_of_national_liberation]]

⥅ related node [[20210526163915 israel]]

⥅ related node [[20210526163919 palestine]]

⥅ related node [[20210526163941 national_liberation]]

⥅ related node [[20210526164307 marxism_leninism]]

⥅ related node [[20210526164922 internal_colony]]

⥅ related node [[20210526164949 black_liberation]]

⥅ related node [[20210527102924 chess]]

⥅ related node [[20210527103006 en_passant]]

⥅ related node [[20210527211049 growing_trend_of_nationalist_communism]]

⥅ related node [[20210527211412 social_media]]

⥅ related node [[20210601215414 my_legacy]]

⥅ related node [[20210601215556 we_are_born_too_soon]]

⥅ related node [[20210602134057 fidel_castro]]

⥅ related node [[20210602134733 representative_democracy]]

⥅ related node [[20210603145931 hegel_s_reason]]

⥅ related node [[20210603165737 split_subject]]

⥅ related node [[20210604135536 uncertainty_principle]]

⥅ related node [[20210604135642 observer_effect]]

⥅ related node [[20210604161739 poastr]]

⥅ related node [[20210604161858 webtools]]

⥅ related node [[20210604161922 html]]

⥅ related node [[20210606093840 should_we_abolish_alienation]]

⥅ related node [[20210606094611 alienation_for_marx]]

⥅ related node [[20210606101645 capitalism_commodified_time]]

⥅ related node [[20210606101738 abolition_of_time]]

⥅ related node [[20210606102008 communist_mode_of_production]]

⥅ related node [[20210606102252 communist_movements_of_the_20th_century]]

⥅ related node [[20210606102544 eastern_bloc]]

⥅ related node [[20210606102621 people_s_republic_of_china]]

⥅ related node [[20210606102729 yugoslavia]]

⥅ related node [[20210606102824 people_s_republic]]

⥅ related node [[20210606103216 korea]]

⥅ related node [[20210606103219 vietnam]]

⥅ related node [[20210606104036 maoism]]

⥅ related node [[20210606135025 communism_cannot_be_a_rolling_back_of_the_clock]]

⥅ related node [[20210606135446 abolition_of_money]]

⥅ related node [[20210606213002 capitalism_manages_the_economy_in_a_decentralized_manner]]

⥅ related node [[20210607154159 idris]]

⥅ related node [[20210607154216 pure_functional_programming]]

⥅ related node [[20210607154420 idempotency]]

⥅ related node [[20210607155229 side_effect]]

⥅ related node [[20210607202511 referential_transparency]]

⥅ related node [[20210607203034 partial_application]]

⥅ related node [[20210607203539 typescript]]

⥅ related node [[20210607204228 currying]]

⥅ related node [[20210607210239 total_function]]

⥅ related node [[20210607212826 is_china_capitalist]]

⥅ related node [[20210609195030 subtyping]]

⥅ related node [[20210609201341 lenin_s_theory_of_imperialism]]

⥅ related node [[20210611095810 to_what_extent_was_the_soviet_union_planned]]

⥅ related node [[20210611100026 non_mode_of_production]]

⥅ related node [[20210612163151 the_role_of_the_state_and_revolution]]

⥅ related node [[20210612163851 lower_phase_of_communism]]

⥅ related node [[20210612163856 higher_phase_of_communism]]

⥅ related node [[20210612163923 withering_of_the_state]]

⥅ related node [[20210612164146 evolutionary_socialism]]

⥅ related node [[20210612165445 labor_time_accounting]]

⥅ related node [[20210612171421 roman_culture]]

⥅ related node [[20210612171432 ancient_greece]]

⥅ related node [[20210612172102 ethnicity]]

⥅ related node [[20210613140008 death_drive]]

⥅ related node [[20210613141231 pleasure_principle]]

⥅ related node [[20210616210305 councils_as_a_revolutionary_unit]]

⥅ related node [[20210617212226 political_action_should_avoid_endless_meetings]]

⥅ related node [[20210617212917 treaty_of_versailles]]

⥅ related node [[20210620091821 is_nationalism_is_a_dead_end]]

⥅ related node [[20210620092008 left_nationalism]]

⥅ related node [[20210621205248 the_masses_are_more_revolutionary_than_parties]]

⥅ related node [[20210621205658 role_of_a_communist_party]]

⥅ related node [[20210625140355 buddha]]

⥅ related node [[20210625140811 lack]]

⥅ related node [[20210626155650 left_communism]]

⥅ related node [[20210626155827 kapd]]

⥅ related node [[20210626163228 inflation]]

⥅ related node [[20210630063134 the_bolsheviks_didn_t_have_an_economic_plan]]

⥅ related node [[20210708153905 opera_mate]]

⥅ related node [[20210708154016 checkmate_pattern]]

⥅ related node [[20210708160418 macros]]

⥅ related node [[20210708161728 programming_language_extension]]

⥅ related node [[20210712162915 foreign_policy_contrarianism]]

⥅ related node [[20210712163004 america_is_the_global_hegemon]]

⥅ related node [[20210712163124 foreign_policy]]

⥅ related node [[20210712164445 iran]]

⥅ related node [[20210712164759 cia]]

⥅ related node [[20210712164936 the_singularity_will_not_happen]]

⥅ related node [[20210713170740 lisp_timestamp]]

⥅ related node [[20210713213112 idris2]]

⥅ related node [[20210714210745 variety]]

⥅ related node [[20210714212927 skills_gap]]

⥅ related node [[20210714214748 panopticon]]

⥅ related node [[20210714215033 data_is_a_commodity]]

⥅ related node [[20210714215054 data]]

⥅ related node [[20210715122057 tower_metaphor]]

⥅ related node [[20210715213712 jouissance_is_like_an_abstraction_of_drug_addiction]]

⥅ related node [[20210718115603 oauth]]

⥅ related node [[20210718115629 web_service]]

⥅ related node [[20210719153139 blockchain]]

⥅ related node [[20210719153303 bitcoin]]

⥅ related node [[20210719153323 can_a_blockchain_be_used_for_socialism]]

⥅ related node [[20210719161227 the_logic_of_cryptocurrency_is_inherently_capitalist]]

⥅ related node [[20210719163343 proof_of_work]]

⥅ related node [[20210719214830 the_george_floyd_rebellions_were_spontaneous]]

⥅ related node [[20210719225127 spontaneity]]

⥅ related node [[20210720152815 hegel_believed_that_alienation_was_what_made_us_human]]

⥅ related node [[20210720191352 knowledge_is_a_social_process]]

⥅ related node [[20210720191620 reality_is_living_experience]]

⥅ related node [[20210720192635 science_is_not_the_sole_source_of_knowledge]]

⥅ related node [[20210720192702 logical_positivism]]

⥅ related node [[20210720193219 psychology]]

⥅ related node [[20210720193512 institution_of_science]]

⥅ related node [[20210720200716 eugenics]]

⥅ related node [[20210720201100 hermeticism]]

⥅ related node [[harvey]]

⥅ related node [[20200604222604 the_little_schemer]]

⥅ related node [[20200607142108 roberts_returning_to_normal]]

⥅ related node [[20200607221703 a_world_to_win]]

⥅ related node [[20200609203608 cosmonaut_mask_off_crisis_and_struggle_in_the_pandemic]]

⥅ related node [[20200611201622 cleaver_commentary_on_chapter_26_of_capital]]

⥅ related node [[20200611201816 capital]]

⥅ related node [[20200617233631 how_to_take_smart_notes]]

⥅ related node [[20200621105509 cosmopod_komsomol_life]]

⥅ related node [[20200623221652 it_was_the_virus_that_did_it_michael_robert_s_blog]]

⥅ related node [[20200628191019 fictions_borges]]

⥅ related node [[20200629132641 so_tell_me_about_nix]]

⥅ related node [[20200705152342 getting_things_done]]

⥅ related node [[20200705171017 how_to_take_smart_notes_roam_research_video]]

⥅ related node [[20200706092304 rudolf_hilferding_and_social_democracy_pop_the_left]]

⥅ related node [[20200709205010 statue_i_hardly_know_you_the_antifada]]

⥅ related node [[20200712110353 a_few_things_to_keep_in_mind]]

⥅ related node [[20200712110501 principles]]

⥅ related node [[20200712110654 three_types_of_notes]]

⥅ related node [[20200712111235 three_types_of_note_taking_mistakes]]

⥅ related node [[20200712121954 six_steps_to_successful_writing]]

⥅ related node [[20200713095402 007_18th_brumaire_from_alpha_to_omega]]

⥅ related node [[20200720093851 marx_s_ecology_cosmopod]]

⥅ related node [[20200720093957 marx_s_ecology]]

⥅ related node [[20200720100823 the_long_twentieth_century]]

⥅ related node [[20200720132822 javascript_engines_the_good_parts]]

⥅ related node [[20200720151128 fritjof_capra_the_web_of_life]]

⥅ related node [[20200720200919 the_philosophy_of_living_experience]]

⥅ related node [[20201014222130 capital_vol_2]]

⥅ related node [[20201129134741 a_companion_to_marx_s_capital_vol_2]]

⥅ related node [[20201223154314 trench_warfare_mike_davis]]

⥅ related node [[20210103203640 elements_of_technology_criticism]]

⥅ related node [[20210103210656 a_popular_history_of_the_fed]]

⥅ related node [[20210110164458 anti_semitism_and_national_socialism_moishe_postone]]

⥅ related node [[20210111112227 kickstarter_united_general_intellect_unit]]

⥅ related node [[20210111120453 lasch_back_w_douglas_lain_the_antifada]]

⥅ related node [[20210116145100 act4e_session_1_transmutation]]

⥅ related node [[20210117123933 act4e_session_2_connection]]

⥅ related node [[20210120214919 how_to_make_a_pencil_logic_magazine]]

⥅ related node [[20210218215225 deflation_inflation_or_stagflation_michael_roberts]]

⥅ related node [[20210302133927 the_revolutionary_karl_kautsky_cosmonaut]]

⥅ related node [[20210304093045 the_chinese_rural_commune_cosmopod]]

⥅ related node [[20210306155518 automation_and_the_future_of_work]]

⥅ related node [[20210307152720 lisp_in_small_pieces]]

⥅ related node [[20210310111808 wtf_is_marxism_dialectics_shake_the_world_mortal_science]]

⥅ related node [[20210313165004 hegel_dialectics_and_posiwid]]

⥅ related node [[20210321183132 don_t_kronstadt_me_bro_the_antifada]]

⥅ related node [[20210321202719 singular_plural_logic_mag]]

⥅ related node [[20210321203540 enter_the_dragnet_logic_mag]]

⥅ related node [[20210321210839 panopticons_and_leviathans_logic_mag]]

⥅ related node [[20210326181613 building_better_technology_together_logic_mag]]

⥅ related node [[20210326182858 specter_in_the_machine_logic_mag]]

⥅ related node [[20210403125401 the_ideology_of_late_imperialism_monthly_review]]

⥅ related node [[20210403145821 racial_capitalism_and_covid_19]]

⥅ related node [[20210405165210 decelerate_now_logic_mag]]

⥅ related node [[20210405170530 capital_science_technology_monthly_review]]

⥅ related node [[20210420105203 where_to_start_1_the_psychoanalytic_theorists_why_theory]]

⥅ related node [[20210421110629 defending_freud_side_a_why_theory]]

⥅ related node [[20210421162919 defending_freud_side_b_why_theory]]

⥅ related node [[20210423123830 type_driven_development_with_idris]]

⥅ related node [[20210426153007 the_class_struggle_in_contemporary_china_cosmopod]]

⥅ related node [[20210427201247 repairing_the_soil_carbon_rift]]

⥅ related node [[20210502162113 dialectics_of_nature]]

⥅ related node [[20210504205409 the_lost_revolution_germany_1918_to_1923]]

⥅ related node [[20210504212056 the_miracle_of_the_commons_aeon]]

⥅ related node [[20210506152844 deleuze_with_guattari_why_theory]]

⥅ related node [[20210506152951 anti_oedipus]]

⥅ related node [[20210506153019 a_thousand_plateus]]

⥅ related node [[20210509131559 deleuze_before_guattari_why_theory]]

⥅ related node [[20210511100220 deleuze_after_guattari_why_theory]]

⥅ related node [[20210516163844 parse_don_t_validate]]

⥅ related node [[20210516173242 lexical_analysis_in_racket]]

⥅ related node [[20210520104635 contradiction_why_theory]]

⥅ related node [[20210523160231 the_class_struggle_karl_kautsky]]

⥅ related node [[20210526115604 dialectics_why_theory]]

⥅ related node [[20210602130026 cuba_past_present_and_future_cosmopod]]

⥅ related node [[20210603145821 hegel_s_reason_why_theory]]

⥅ related node [[20210603152807 the_soviet_chess_primer]]

⥅ related node [[20210607212625 why_china_is_capitalist_pm_press]]

⥅ related node [[20210612151339 the_erfurt_program_karl_kautsky]]

⥅ related node [[20210612154000 evolutionary_socialism_chapter_3_eduard_bernstein]]

⥅ related node [[20210612171050 who_was_allowed_to_call_the_roman_empire_home_aeon]]

⥅ related node [[20210708154354 why_you_shouldn_t_obsess_about_rust_features]]

⥅ related node [[20210714203633 nihilist_communism]]

⥅ related node [[20210714203700 designing_freedom]]

⥅ related node [[20210714212557 the_access_doctrine_logic_mag]]

⥅ related node [[20210714213814 don_t_call_it_a_throwback_logic_mag]]

⥅ related node [[20210714214523 data_relations_logic_mag]]

⥅ related node [[a_companion_to_marx_s_capital]]

⥅ related node [[abiogenesis]]

⥅ related node [[aigarchaeota]]

⥅ related node [[alternation of generations]]

⥅ related node [[alveolata]]

⥅ related node [[aly]]

⥅ related node [[amniota]]

⥅ related node [[amoebocytes]]

⥅ related node [[amoebozoa]]

⥅ related node [[animalia]]

⥅ related node [[apicomplexa]]

⥅ related node [[archaea]]

⥅ related node [[archaean]]

⥅ related node [[archaeplastida]]

⥅ related node [[pxl_20211218_194913834]]

⥅ related node [[pxl_20211218_195853384]]

⥅ related node [[pxl_20211218_200922046]]

⥅ related node [[pxl_20211218_202030468]]

⥅ related node [[pxl_20211218_202039762]]

⥅ related node [[pxl_20211218_203039499]]

⥅ related node [[pxl_20211218_203108395]]

⥅ related node [[pxl_20211218_203317598]]

⥅ related node [[pxl_20211218_204439217]]

⥅ related node [[pxl_20211218_213131180]]

⥅ related node [[pxl_20211218_213457200]]

⥅ related node [[pxl_20211218_213921550]]

⥅ related node [[pxl_20211218_214657828]]

⥅ related node [[pxl_20211218_215522752]]

⥅ related node [[pxl_20211218_231512715]]

⥅ related node [[pxl_20211219_020112786]]

⥅ related node [[autocatalytic set]]

⥅ related node [[aveao]]

⥅ related node [[bedwars]]

⥅ related node [[bell state]]

⥅ related node [[bilateria]]

⥅ related node [[brown algae]]

⥅ related node [[card game]]

⥅ related node [[card]]

⥅ related node [[cenozoic]]

⥅ related node [[chalkbot]]

⥅ related node [[chatchat]]

⥅ related node [[chemotaxis]]

⥅ related node [[chisel]]

⥅ related node [[chlamydiae]]

⥅ related node [[choanoflagellatea]]

⥅ related node [[chordata]]

⥅ related node [[chytridiomycota]]

⥅ related node [[ciliophora]]

⥅ related node [[cleavage divisions]]

⥅ related node [[cnidaria]]

⥅ related node [[computational diffie hellman]]

⥅ related node [[controlled not]]

⥅ related node [[crenarchaeota]]

⥅ related node [[cryogenian]]

⥅ related node [[cyanobacteria]]

⥅ related node [[decisional diffie hellman]]

⥅ related node [[decompilation]]

⥅ related node [[degreetech]]

⥅ related node [[deuterostomia]]

⥅ related node [[diatoms]]

⥅ related node [[dinoflagellata]]

⥅ related node [[diplomonadida]]

⥅ related node [[discrete logarithm]]

⥅ related node [[ediacaran]]

⥅ related node [[elements of game design]]

⥅ related node [[embryophyta]]

⥅ related node [[endosymbiosis]]

⥅ related node [[endothermy]]

⥅ related node [[euglenozoa]]

⥅ related node [[eukarya]]

⥅ related node [[eumetazoa]]

⥅ related node [[eumycetozoa]]

⥅ related node [[euryarchaeota]]

⥅ related node [[eutracheophyta]]

⥅ related node [[excavata]]

⥅ related node [[factoring]]

⥅ related node [[fermicutes]]

⥅ related node [[fourier basis]]

⥅ related node [[fourier vector]]

⥅ related node [[fs2]]

⥅ related node [[game design frameworks]]

⥅ related node [[gastrula]]

⥅ related node [[geologic timeline]]

⥅ related node [[ggm construction]]

⥅ related node [[ghidra]]

⥅ related node [[gnathostomata]]

⥅ related node [[hadamard gate]]

⥅ related node [[hadean]]

⥅ related node [[heterokonta]]

⥅ related node [[hoopy the hoop]]

⥅ related node [[horizon eda]]

⥅ related node [[hox genes]]

⥅ related node [[huronian glaciation]]

⥅ related node [[hypixel]]

⥅ related node [[inner product]]

⥅ related node [[java virtual machine]]

⥅ related node [[java]]

⥅ related node [[jesyspa]]

⥅ related node [[ket]]

⥅ related node [[korarchaeota]]

⥅ related node [[leyland james kirby]]

⥅ related node [[linuxgemini]]

⥅ related node [[lnmds]]

⥅ related node [[lokiarchaeota]]

⥅ related node [[masm assembly]]

⥅ related node [[measurement]]

⥅ related node [[mechanics dynamics aesthetics]]

⥅ related node [[mesozoic]]

⥅ related node [[metamonada]]

⥅ related node [[metazoa]]

⥅ related node [[minecraft but its everywhere at the end of time]]

⥅ related node [[minecraft]]

⥅ related node [[minuskelvin]]

⥅ related node [[mitochondrion]]

⥅ related node [[modding]]

⥅ related node [[molecular evolutionary genetics analysis]]

⥅ related node [[monadmachines]]

⥅ related node [[monilophytes]]

⥅ related node [[morphogenesis]]

⥅ related node [[neoproterozoic]]

⥅ related node [[niwa]]

⥅ related node [[norm]]

⥅ related node [[np complete]]

⥅ related node [[np hard]]

⥅ related node [[np]]

⥅ related node [[oomycota]]

⥅ related node [[opisthokonta]]

⥅ related node [[order]]

⥅ related node [[orthonormal]]

⥅ related node [[osteichthyes]]

⥅ related node [[outer product]]

⥅ related node [[paleozoic]]

⥅ related node [[parabasalia]]

⥅ related node [[pauli operators]]

⥅ related node [[petrl]]

⥅ related node [[phanerozoic]]

⥅ related node [[polysporangiophyta]]

⥅ related node [[positioning statement]]

⥅ related node [[probabilistic polynomial time]]

⥅ related node [[programming language]]

⥅ related node [[proteobacteria]]

⥅ related node [[proterozoic]]

⥅ related node [[protista]]

⥅ related node [[protostomia]]

⥅ related node [[quantum fourier transform]]

⥅ related node [[quantum state]]

⥅ related node [[radiata]]

⥅ related node [[rna world]]

⥅ related node [[samseawell]]

⥅ related node [[sar supergroup]]

⥅ related node [[shortlinks]]

⥅ related node [[sirius902]]

⥅ related node [[sledge]]

⥅ related node [[spermatophytes]]

⥅ related node [[spirochaeta]]

⥅ related node [[sponge]]

⥅ related node [[stromatolites]]

⥅ related node [[tack supergroup]]

⥅ related node [[tenri]]

⥅ related node [[tensor product]]

⥅ related node [[tetrapodomorpha]]

⥅ related node [[thaumarchaeota]]

⥅ related node [[the caretaker]]

⥅ related node [[the great oxygenation]]

⥅ related node [[the legend of zelda ocarina of time]]

⥅ related node [[the legend of zelda the wind waker]]

⥅ related node [[the legend of zelda]]

⥅ related node [[toffoli gate]]

⥅ related node [[uc santa cruz]]

⥅ related node [[unikonta]]

⥅ related node [[unitary operator]]

⥅ related node [[urbilaterian]]

⥅ related node [[vertebrata]]

⥅ related node [[video game]]

⥅ related node [[zig]]

⥅ related node [[a conversation with bourriaud and artnews]]

⥅ related node [[altermodernism explained]]

⥅ related node [[blockchain voting with santiago siri]]

⥅ related node [[cybernetics wiki]]

⥅ related node [[flexible knowledge synthesis a practical guide]]

⥅ related node [[from globalization to a planetary mindset]]

⥅ related node [[hauling democracy out of the 19th century]]

⥅ related node [[in love with the world]]

⥅ related node [[only a god can save us heidegger and der spiegel]]

⥅ related node [[singularity vs daoist robots]]

⥅ related node [[sopranos and yeats]]

⥅ related node [[taiwanese legal crowdsourcing]]

⥅ related node [[the computational turn]]

⥅ related node [[the costs of an oversanitized world]]

⥅ related node [[anime]]

⥅ related node [[christmas 2020]]

⥅ related node [[csgo]]

⥅ related node [[genshin impact]]

⥅ related node [[komi cant communicate]]

⥅ related node [[machikado mazoku]]

⥅ related node [[manga]]

⥅ related node [[mindustry]]

⥅ related node [[osu]]

⥅ related node [[rocket league]]

⥅ related node [[setup]]

⥅ related node [[texas 2021 power outage]]

⥅ related node [[rectification of names]]

⥅ related node [[credit commons protocol]]

⥅ related node [[ip address]]

⥅ related node [[address]]

⥅ related node [[part]]

⥅ related node [[unrival]]

⥅ related node [[assessment]]

⥅ related node [[blob]]

⥅ related node [[interpretation]]

⥅ related node [[ledger]]

⥅ related node [[name]]

⥅ related node [[object]]

⥅ related node [[proof]]

⥅ related node [[iframe test]]

⥅ related node [[2021 07 29]]

⥅ related node [[2021 08 26]]

⥅ related node [[ethmail]]

⥅ related node [[flancia social impact]]

⥅ related node [[giving tuesday]]

⥅ related node [[grant proposal writing]]

⥅ related node [[hypha 2021 10 13]]

⥅ related node [[infatuation]]

⥅ related node [[keybase alternatives]]

⥅ related node [[knowledge arrangement reading group]]

⥅ related node [[michael parenti]]

⥅ related node [[mysilio]]

⥅ related node [[nasa call]]

⥅ related node [[new york city organized crime]]

⥅ related node [[nonprofit funding]]

⥅ related node [[pdx zebras call 2021 08 26]]

⥅ related node [[pdx zebras meetings]]

⥅ related node [[peer to peer fundraising]]

⥅ related node [[pending tax exempt status]]

⥅ related node [[popular power]]

⥅ related node [[portland zebras 2021 07 15]]

⥅ related node [[portland zebras 2021 07 22]]

⥅ related node [[portland zebras 2021 09 02]]

⥅ related node [[portland zu 2021 07 29]]

⥅ related node [[portland zu 2021 09 16]]

⥅ related node [[sci hub]]

⥅ related node [[substantiating donations]]

⥅ related node [[tani call 2021 10 21]]

⥅ related node [[yaka]]

⥅ related node [[zebras 2021 08 19]]

⥅ related node [[zebras chapter orientation slides]]

⥅ related node [[1984 02 16]]

⥅ related node [[2012 10 26]]

⥅ related node [[about flagmatic plugin]]

⥅ related node [[about video plugin]]

⥅ related node [[agora todo]]

⥅ related node [[albert bandura]]

⥅ related node [[anarchy test]]

⥅ related node [[assets folder]]

⥅ related node [[blockhain]]

⥅ related node [[blow pony]]

⥅ related node [[bullshido]]

⥅ related node [[clojurescript resources]]

⥅ related node [[collective flow]]

⥅ related node [[comparing zettelkasten and agora]]

⥅ related node [[creative confidence]]

⥅ related node [[data dump]]

⥅ related node [[david bovill]]

⥅ related node [[david kelley]]

⥅ related node [[detail square centers]]

⥅ related node [[download to upload]]

⥅ related node [[drugs]]

⥅ related node [[dunningkruger effect]]

⥅ related node [[ein]]

⥅ related node [[eric dobbs]]

⥅ related node [[federated technology]]

⥅ related node [[fedwiki to agora markdown converter]]

⥅ related node [[grace quotes]]

⥅ related node [[innovate oregon]]

⥅ related node [[interesting ted talks]]

⥅ related node [[interests]]

⥅ related node [[kinds of fedwiki people]]

⥅ related node [[linking rules]]

⥅ related node [[markdown factory]]

⥅ related node [[ohsu]]

⥅ related node [[on bullshit]]

⥅ related node [[on mount stupid]]

⥅ related node [[pierian spring]]

⥅ related node [[portland]]

⥅ related node [[prehab]]

⥅ related node [[private and public data]]

⥅ related node [[scratch]]

⥅ related node [[self efficacy]]

⥅ related node [[sense of efficacy]]

⥅ related node [[shadow cljs]]

⥅ related node [[shae tattoo 2021 10 27]]

⥅ related node [[shortest ted talk]]

⥅ related node [[sunday pioneers]]

⥅ related node [[the dayton experiment]]

⥅ related node [[types]]

⥅ related node [[vera quotes]]

⥅ related node [[vocabulary]]

⥅ related node [[ward]]

⥅ related node [[yolo]]

⥅ related node [[you arent gonna need it]]

⥅ related node [[zsync]]

⥅ related node [[0data app]]

⥅ related node [[2021 w22]]

⥅ related node [[2021 w23]]

⥅ related node [[2021 w24]]

⥅ related node [[2021 w25]]

⥅ related node [[2021 w27]]

⥅ related node [[2022 01 09 scratch]]

⥅ related node [[3d modeling]]

⥅ related node [[a confluence of waters]]

⥅ related node [[a b o]]

⥅ related node [[acsl]]

⥅ related node [[agora containers]]

⥅ related node [[agora conventions]]

⥅ related node [[agora ctzn docs]]

⥅ related node [[agora ext feature ideas]]

⥅ related node [[agora git mapping]]

⥅ related node [[agora governance system]]

⥅ related node [[agora governance]]

⥅ related node [[agora groups]]

⥅ related node [[agora interlay graph]]

⥅ related node [[agora interlay howto]]

⥅ related node [[agora issues]]

⥅ related node [[agora obsidian plugin]]

⥅ related node [[agora proposal 1]]

⥅ related node [[agora proposal platform]]

⥅ related node [[agora proposal]]

⥅ related node [[agora proposals]]

⥅ related node [[agora server build docs]]

⥅ related node [[althea]]

⥅ related node [[ansi art]]

⥅ related node [[anti dictionary]]

⥅ related node [[anti pattern]]

⥅ related node [[aphid]]

⥅ related node [[arweave]]

⥅ related node [[asch experiment]]

⥅ related node [[atak]]

⥅ related node [[audio timeline]]

⥅ related node [[avatar]]

⥅ related node [[band protocol]]

⥅ related node [[benhylau]]

⥅ related node [[betterexplained]]

⥅ related node [[blockchain research]]

⥅ related node [[bookchin quotes]]

⥅ related node [[bookchin]]

⥅ related node [[bookmarks]]

⥅ related node [[born rule]]

⥅ related node [[brig]]

⥅ related node [[broot]]

⥅ related node [[cerebrum]]

⥅ related node [[chemo therapy]]

⥅ related node [[chemo]]

⥅ related node [[closing wikilinks]]

⥅ related node [[command line shortcuts]]

⥅ related node [[commonmark]]

⥅ related node [[communal house]]

⥅ related node [[concrete nouns]]

⥅ related node [[conferencing]]

⥅ related node [[contribute]]

⥅ related node [[conversations]]

⥅ related node [[cool apps]]

⥅ related node [[coolors]]

⥅ related node [[corona vaccination]]

⥅ related node [[cosmos atom]]

⥅ related node [[cosmos hub]]

⥅ related node [[cosmos sdk]]

⥅ related node [[create your own content]]

⥅ related node [[crypto currency]]

⥅ related node [[crypto market]]

⥅ related node [[ctzn bot]]

⥅ related node [[darcy]]

⥅ related node [[data commons coalition]]

⥅ related node [[day planner 20210605]]

⥅ related node [[day planner 20210613]]

⥅ related node [[day planner 20210617]]

⥅ related node [[day planner 20210621]]

⥅ related node [[day planner 20210625]]

⥅ related node [[day planner 20210629]]

⥅ related node [[day planner 20210630]]

⥅ related node [[day planner 20210701]]

⥅ related node [[day planner 20210702]]

⥅ related node [[day planner 20210703]]

⥅ related node [[day planner 20210704]]

⥅ related node [[day planner 20210705]]

⥅ related node [[day planner 20210706]]

⥅ related node [[day planner 20210708]]

⥅ related node [[day planner 20210709]]

⥅ related node [[day planner 20210710]]

⥅ related node [[day planner 20210712]]

⥅ related node [[dcwalker]]

⥅ related node [[decentralized social media]]

⥅ related node [[deep linking]]

⥅ related node [[defi]]

⥅ related node [[democracyos]]

⥅ related node [[depression]]

⥅ related node [[dialectical tension]]

⥅ related node [[digital garden history]]

⥅ related node [[discussion is ephemeral]]

⥅ related node [[distributed interest orgs]]

⥅ related node [[dlt]]

⥅ related node [[dmitri dates]]

⥅ related node [[dmitri]]

⥅ related node [[dns search domain]]

⥅ related node [[dogmatist]]

⥅ related node [[dweb talk 2021 06 02]]

⥅ related node [[ebook resources]]

⥅ related node [[emotional narrative]]

⥅ related node [[english as she is spoke]]

⥅ related node [[eternal truths of mathematics and science]]

⥅ related node [[ethermint]]

⥅ related node [[ethical source]]

⥅ related node [[ever expanding project]]

⥅ related node [[eye bleach]]

⥅ related node [[fanfic]]

⥅ related node [[fatal ambiguity]]

⥅ related node [[federated networks]]

⥅ related node [[federated profile]]

⥅ related node [[federated social media networks]]

⥅ related node [[federation bubble]]

⥅ related node [[fedi client]]

⥅ related node [[fedi server]]

⥅ related node [[fedi]]

⥅ related node [[flancia matrix space]]

⥅ related node [[flancia office]]

⥅ related node [[flancia projects]]

⥅ related node [[fragility]]

⥅ related node [[fully vaccinated]]

⥅ related node [[gardener coalition]]

⥅ related node [[gemini protocol]]

⥅ related node [[generosity of leadership]]

⥅ related node [[gerontocracy]]

⥅ related node [[git hooks]]

⥅ related node [[git revert changes]]

⥅ related node [[global democratic moderation]]

⥅ related node [[global id]]

⥅ related node [[golang]]

⥅ related node [[gomuks]]

⥅ related node [[gparted]]

⥅ related node [[gravity bridge]]

⥅ related node [[gravity dex]]

⥅ related node [[how to find a validator]]

⥅ related node [[htop]]

⥅ related node [[hyperdraft]]

⥅ related node [[hypha call 2021 05 04]]

⥅ related node [[ibc protocol]]

⥅ related node [[icon duck]]

⥅ related node [[immer protocol]]

⥅ related node [[impact fund]]

⥅ related node [[implications of quantum mechanics on philosophy]]

⥅ related node [[in and out]]

⥅ related node [[industry terms]]

⥅ related node [[informational complexity]]

⥅ related node [[integration of the agora]]

⥅ related node [[intentional living]]

⥅ related node [[interesting hubs]]

⥅ related node [[interesting net art]]

⥅ related node [[interesting sites]]

⥅ related node [[internet accessibility]]

⥅ related node [[interpretations of quantum mechanics]]

⥅ related node [[iso image]]

⥅ related node [[issue tracker]]

⥅ related node [[jana]]

⥅ related node [[jineologi]]

⥅ related node [[journal nodes]]

⥅ related node [[jstor]]

⥅ related node [[kanopy]]

⥅ related node [[kava]]

⥅ related node [[kazakhstan]]

⥅ related node [[lainsafe]]

⥅ related node [[launchy]]

⥅ related node [[librephotos]]

⥅ related node [[liz fong jones]]

⥅ related node [[logical tea party]]

⥅ related node [[lxqt]]

⥅ related node [[maggie appleton garden]]

⥅ related node [[mail tracker]]

⥅ related node [[manjaro]]

⥅ related node [[mara call 2021 06 10]]

⥅ related node [[masto]]

⥅ related node [[mastodon twitter crossposter]]

⥅ related node [[matrix spaces]]

⥅ related node [[maya kate]]

⥅ related node [[meetings 2021 05 19]]

⥅ related node [[meetings 2021 05 20]]

⥅ related node [[meetings 2021 05 21]]

⥅ related node [[meetings]]

⥅ related node [[minimum viable exchange format]]

⥅ related node [[ms]]

⥅ related node [[muggle work]]

⥅ related node [[multiple sclerosis]]

⥅ related node [[nameservice]]

⥅ related node [[near]]

⥅ related node [[net freedom]]

⥅ related node [[nft art]]

⥅ related node [[nft minter]]

⥅ related node [[nft news]]

⥅ related node [[node categories]]

⥅ related node [[note refactoring]]

⥅ related node [[notes on communism]]

⥅ related node [[notes on old books]]

⥅ related node [[notes on quantum mechanics]]

⥅ related node [[notes on the opression of women]]

⥅ related node [[obsidian mobile]]

⥅ related node [[obsidian testing]]

⥅ related node [[ocr]]

⥅ related node [[oculus rift usb c]]

⥅ related node [[oilshell]]

⥅ related node [[ontic structural realism]]

⥅ related node [[open source democracy]]

⥅ related node [[open source governance]]

⥅ related node [[opensea]]

⥅ related node [[orid]]

⥅ related node [[otter]]

⥅ related node [[our networks]]

⥅ related node [[overlinking]]

⥅ related node [[panlex]]

⥅ related node [[partido de la red]]

⥅ related node [[passive learning]]

⥅ related node [[pasted image 20210120211015]]

⥅ related node [[pasted image 20210604121534]]

⥅ related node [[pasted image 20210604122001]]

⥅ related node [[pasted image 20210604122655]]

⥅ related node [[patcon 2021 05 21]]

⥅ related node [[patcon]]

⥅ related node [[pay to win]]

⥅ related node [[peertube]]

⥅ related node [[phrase express]]

⥅ related node [[pia call 2021 05 20]]

⥅ related node [[pia mancini]]

⥅ related node [[pia ted talk]]

⥅ related node [[pinata cloud]]

⥅ related node [[plan file]]

⥅ related node [[portis wallet]]

⥅ related node [[portland apparel lab]]

⥅ related node [[pr review 2021 06 23]]

⥅ related node [[prefrontal cortex]]

⥅ related node [[preliterate society]]

⥅ related node [[private matrix channel]]

⥅ related node [[prolertarian culture]]

⥅ related node [[proof of humanity]]

⥅ related node [[psychodelic drugs]]

⥅ related node [[purecss]]

⥅ related node [[qualitative palette]]

⥅ related node [[radical cooperation]]

⥅ related node [[rational disscusion and decision making]]

⥅ related node [[rbenv]]

⥅ related node [[real talk]]

⥅ related node [[red army killed black army]]

⥅ related node [[refactoring notes]]

⥅ related node [[regen network]]

⥅ related node [[remotestorage]]

⥅ related node [[republic services]]

⥅ related node [[reputation system]]

⥅ related node [[reviewing old notes]]

⥅ related node [[rocket dock]]

⥅ related node [[romcom ideas]]

⥅ related node [[routine]]

⥅ related node [[ruby]]

⥅ related node [[sablier finance]]

⥅ related node [[screenshot_20210530 135612]]

⥅ related node [[scrying pen]]

⥅ related node [[self sovereign identity]]

⥅ related node [[self locating uncertainty]]

⥅ related node [[semantic idea]]

⥅ related node [[session]]

⥅ related node [[sessionbox]]

⥅ related node [[shae redirect]]

⥅ related node [[shae]]

⥅ related node [[simplecss]]

⥅ related node [[single dose vaccine]]

⥅ related node [[slash]]

⥅ related node [[smol web]]

⥅ related node [[social api]]

⥅ related node [[solidarity fund]]

⥅ related node [[spaced repetition testing]]

⥅ related node [[spike]]

⥅ related node [[spritelyproject]]

⥅ related node [[stake fish]]

⥅ related node [[staking]]

⥅ related node [[starport]]

⥅ related node [[struggle of nature and society]]

⥅ related node [[subway tooter]]

⥅ related node [[swamp person]]

⥅ related node [[tailscale]]

⥅ related node [[taizen]]

⥅ related node [[tend the garden]]

⥅ related node [[tendermint]]

⥅ related node [[tending the garden]]

⥅ related node [[terrance mckenna]]

⥅ related node [[the anti capitalist software license]]

⥅ related node [[the weed tube]]

⥅ related node [[trans in public]]

⥅ related node [[underscore protocol]]

⥅ related node [[understory call 2021 05 27]]

⥅ related node [[understory call 2021 06 04]]

⥅ related node [[universal topography]]

⥅ related node [[usd]]

⥅ related node [[user controlled data store]]

⥅ related node [[vaccination card]]

⥅ related node [[vaccine]]

⥅ related node [[ventoy]]

⥅ related node [[vera nft]]

⥅ related node [[vera requests]]

⥅ related node [[virtual reign immersive chess launch party]]

⥅ related node [[visual masturbation]]

⥅ related node [[vlang]]

⥅ related node [[volcano]]

⥅ related node [[vr headsets]]

⥅ related node [[vr spaces]]

⥅ related node [[vrm]]

⥅ related node [[vroid]]

⥅ related node [[vtuber]]

⥅ related node [[w3id]]

⥅ related node [[web palette]]

⥅ related node [[wetransfer]]

⥅ related node [[workbench]]

⥅ related node [[world at war]]

⥅ related node [[wt social]]

⥅ related node [[wtf is the agora]]

⥅ related node [[zebra call 2021 05 31]]

⥅ related node [[zebras call 2021 06 17]]

⥅ related node [[zenbook]]

⥅ related node [[zu chapter orientation 2021 07 08]]

⥅ related node [[zu portland 2021 07 08]]

⥅ related node [[apps obsidian]]

⥅ related node [[trivia]]

⥅ related node [[run an agora]]

⥅ related node [[2022 09 30]]

⥅ related node [[2024 01 06]]

⥅ related node [[30 days]]

⥅ related node [[[[5 2 2022]]]]

⥅ related node [[agora 2023]]

⥅ related node [[agora bot test]]

⥅ related node [[agora digital garden]]

⥅ related node [[agora platform]]

⥅ related node [[ajhalili2006]]

⥅ related node [[alexandra elbakyan]]

⥅ related node [[alfred korzybski]]

⥅ related node [[aly gallery]]

⥅ related node [[amanita chan]]

⥅ related node [[an vu]]

⥅ related node [[anagora bot treat]]

⥅ related node [[anagora bot]]

⥅ related node [[anagora vision]]

⥅ related node [[anarchist democracy]]

⥅ related node [[any title you want]]

⥅ related node [[appenzeller innerrhoden]]

⥅ related node [[archleucoryx]]

⥅ related node [[argimenes]]

⥅ related node [[arpa paraguaya]]

⥅ related node [[aukey]]

⥅ related node [[avolition]]

⥅ related node [[baking soda]]

⥅ related node [[barry harris]]

⥅ related node [[benjamin]]

⥅ related node [[best wiki]]

⥅ related node [[bestia]]

⥅ related node [[bhavagad giat]]

⥅ related node [[bhavagad gita]]

⥅ related node [[biden]]

⥅ related node [[bignoodle]]

⥅ related node [[bigtimer]]

⥅ related node [[blockingioerror]]

⥅ related node [[brahmavihara]]

⥅ related node [[breh]]

⥅ related node [[burups]]

⥅ related node [[caso padilla]]

⥅ related node [[catgirlification]]

⥅ related node [[charles b jones]]

⥅ related node [[chick]]

⥅ related node [[circuit bending]]

⥅ related node [[cla]]

⥅ related node [[clomipramine]]

⥅ related node [[clonidine]]

⥅ related node [[co write a neobook]]

⥅ related node [[collaborative filtering]]

⥅ related node [[come to find]]

⥅ related node [[communal drift]]

⥅ related node [[compounding effect]]

⥅ related node [[contribution graph]]

⥅ related node [[copia viva]]

⥅ related node [[cors issues]]

⥅ related node [[crocodile dundee]]

⥅ related node [[cross site scripting]]

⥅ related node [[crossref]]

⥅ related node [[css spinners]]

⥅ related node [[cuando]]

⥅ related node [[d2 diagrams]]

⥅ related node [[dall e 2]]

⥅ related node [[dalton]]

⥅ related node [[dark crystal]]

⥅ related node [[datacite]]

⥅ related node [[dayton mills]]

⥅ related node [[dense web]]

⥅ related node [[diaspora protocol]]

⥅ related node [[digital infrapuncture]]

⥅ related node [[dihydrocodeine]]

⥅ related node [[do ship it]]

⥅ related node [[doco]]

⥅ related node [[dodging the memory ball]]

⥅ related node [[dolores weather]]

⥅ related node [[dérive]]

⥅ related node [[earthseed]]

⥅ related node [[ebike]]

⥅ related node [[ehrmann]]

⥅ related node [[eight definitions of cybernetics]]

⥅ related node [[empty]]

⥅ related node [[epistemic justification]]

⥅ related node [[epistemological]]

⥅ related node [[españa]]

⥅ related node [[everyday]]

⥅ related node [[falalala]]

⥅ related node [[famotidine]]

⥅ related node [[feather nujabes]]

⥅ related node [[fep]]

⥅ related node [[filenotfounderror]]

⥅ related node [[fitt s law]]

⥅ related node [[five hindrances]]

⥅ related node [[fixed stoa]]

⥅ related node [[flancian@social coop]]

⥅ related node [[foobar]]

⥅ related node [[forward link]]

⥅ related node [[forward]]

⥅ related node [[fotl threads]]

⥅ related node [[fractal altruism]]

⥅ related node [[friendship realm]]

⥅ related node [[frog]]

⥅ related node [[gabapentin]]

⥅ related node [[git f]]

⥅ related node [[git lfs]]

⥅ related node [[goodhart s law]]

⥅ related node [[google groups]]

⥅ related node [[great vehicle]]

⥅ related node [[group mathematics]]

⥅ related node [[guerilla commenting]]

⥅ related node [[gumroad no full time employees]]

⥅ related node [[hades]]

⥅ related node [[head twitch response]]

⥅ related node [[hermanos gutierrez]]

⥅ related node [[how did taixu die]]

⥅ related node [[hutterites]]

⥅ related node [[immerspace]]

⥅ related node [[index php]]

⥅ related node [[intelligence is compression]]

⥅ related node [[interactive e books]]

⥅ related node [[interface singularity]]

⥅ related node [[interpeer]]

⥅ related node [[inti illimani 3 canto de pueblos andinos]]

⥅ related node [[intimacy gradient]]

⥅ related node [[irací hassler]]

⥅ related node [[irací]]

⥅ related node [[iso 26324]]

⥅ related node [[iywts]]

⥅ related node [[jacques lacan]]

⥅ related node [[janesrevenge]]

⥅ related node [[joel hooks]]

⥅ related node [[jonny@social coop]]

⥅ related node [[jonny|add to wiki]]

⥅ related node [[json_dirs]]

⥅ related node [[kahneman]]

⥅ related node [[karl popper]]

⥅ related node [[kartiak agaram]]

⥅ related node [[kcbr]]

⥅ related node [[kcbrynotmafs]]

⥅ related node [[kexp]]

⥅ related node [[kin dza dza]]

⥅ related node [[kratom]]

⥅ related node [[laaraji]]

⥅ related node [[lability]]

⥅ related node [[ldac]]

⥅ related node [[learn by doing]]

⥅ related node [[linking to songs on the web]]

⥅ related node [[lions mane]]

⥅ related node [[lisdexamfetamine]]

⥅ related node [[lofexidine]]

⥅ related node [[lord halifax]]

⥅ related node [[luvoir]]

⥅ related node [[lélo fiaux]]

⥅ related node [[magura]]

⥅ related node [[mania]]

⥅ related node [[many agoras]]

⥅ related node [[marilyn monroe]]

⥅ related node [[maría corina machado]]

⥅ related node [[massachusetts amherst]]

⥅ related node [[mastodon upgrade]]

⥅ related node [[mate eléctrico]]

⥅ related node [[matrix threads]]

⥅ related node [[mbta]]

⥅ related node [[mechner]]

⥅ related node [[mega thali]]

⥅ related node [[meltdown]]

⥅ related node [[menopausal flushing]]

⥅ related node [[mersenne prime]]

⥅ related node [[metadata is a love letter written to the future]]

⥅ related node [[metasemantic markers]]

⥅ related node [[milei]]

⥅ related node [[modafinil]]

⥅ related node [[moloch jsold example]]

⥅ related node [[morihei ueshiba]]

⥅ related node [[murphy s law]]

⥅ related node [[mustard effect]]

⥅ related node [[myokine]]

⥅ related node [[naloxone]]

⥅ related node [[nassim taleb]]

⥅ related node [[neil s digital garden]]

⥅ related node [[neither vertical nor horizontal a theory of political organisation]]

⥅ related node [[node club season 1]]

⥅ related node [[nordstream]]

⥅ related node [[nosological]]

⥅ related node [[notion replit integration]]

⥅ related node [[nouveau roman]]

⥅ related node [[novela lumpen]]

⥅ related node [[nu genea]]

⥅ related node [[nude ru]]

⥅ related node [[nuggets are really powerful]]

⥅ related node [[oblique cards]]

⥅ related node [[obsidian themeresources]]

⥅ related node [[one dimensional man]]

⥅ related node [[open information]]

⥅ related node [[orgff28e0a]]

⥅ related node [[pangloss]]

⥅ related node [[paperless ng]]

⥅ related node [[pareidolia]]

⥅ related node [[peach]]

⥅ related node [[peopleverse]]

⥅ related node [[pharmacotherapy]]

⥅ related node [[platforms more like shatforms]]

⥅ related node [[political positions of theodore roosevelt]]

⥅ related node [[popper]]

⥅ related node [[pranayama types]]

⥅ related node [[prasangika madhyamaka]]

⥅ related node [[prince of persia]]

⥅ related node [[programming rust]]

⥅ related node [[promethazine]]

⥅ related node [[psychopathology]]

⥅ related node [[quartz]]

⥅ related node [[quipu]]

⥅ related node [[raku]]

⥅ related node [[random restaurant]]

⥅ related node [[rchvngrlsgwrnnt]]

⥅ related node [[rdfs]]

⥅ related node [[readcube]]

⥅ related node [[reentry]]

⥅ related node [[refactoring]]

⥅ related node [[regalos argentina 2022]]

⥅ related node [[riot]]

⥅ related node [[roam tips]]

⥅ related node [[robert]]

⥅ related node [[rochdale society of equitable pioneers]]

⥅ related node [[ruelle]]

⥅ related node [[salmonen]]

⥅ related node [[save civilization]]

⥅ related node [[scaledish]]

⥅ related node [[scrintal]]

⥅ related node [[seattle]]

⥅ related node [[semmy]]

⥅ related node [[sentientes o sintientes]]

⥅ related node [[setting up org roam and anki flashcards]]

⥅ related node [[shai]]

⥅ related node [[shared space]]

⥅ related node [[sheaf]]

⥅ related node [[shopify]]

⥅ related node [[sky woman]]

⥅ related node [[slapstick vonnegut]]

⥅ related node [[socialcoop techmatrix]]

⥅ related node [[software craftmanship]]

⥅ related node [[sorry anagora bot]]

⥅ related node [[sorry anagora]]

⥅ related node [[spiritual practice]]

⥅ related node [[sqlite python3]]

⥅ related node [[ssh]]

⥅ related node [[steiner]]

⥅ related node [[stoa test]]

⥅ related node [[stocksy united]]

⥅ related node [[sunmer with family]]

⥅ related node [[swiss burn]]

⥅ related node [[tang dayuan]]

⥅ related node [[tanmays journey and take on ai]]

⥅ related node [[tannenbaum]]

⥅ related node [[tarot]]

⥅ related node [[tataghatagharba]]

⥅ related node [[tehaku]]

⥅ related node [[teresa wilms montt]]

⥅ related node [[terry davis]]

⥅ related node [[test conversation]]

⥅ related node [[test125]]

⥅ related node [[testing2]]

⥅ related node [[tetradrachm]]

⥅ related node [[thangka paintings]]

⥅ related node [[thank you anagora bot]]

⥅ related node [[the chromium fence]]

⥅ related node [[the mountain goats]]

⥅ related node [[the theory of transfomation in metals and alloys]]

⥅ related node [[this feature is cooler than you thought]]

⥅ related node [[this is not a 404]]

⥅ related node [[this person does not exist]]

⥅ related node [[tick]]

⥅ related node [[tinku]]

⥅ related node [[titlis peak path]]

⥅ related node [[tlc]]

⥅ related node [[to flancian]]

⥅ related node [[tobacco]]

⥅ related node [[todd]]

⥅ related node [[train song]]

⥅ related node [[tramadol]]

⥅ related node [[transcendental model 1 g]]

⥅ related node [[trap queens]]

⥅ related node [[trauerspiel]]

⥅ related node [[trololol]]

⥅ related node [[ttaggg]]

⥅ related node [[tucholsky]]

⥅ related node [[twg 2024]]

⥅ related node [[twitter as zettelkasten]]

⥅ related node [[umwelt]]

⥅ related node [[unblock]]

⥅ related node [[unison]]

⥅ related node [[utopia documents]]

⥅ related node [[uxn legoptics]]

⥅ related node [[videotelephony]]

⥅ related node [[visuddhimagga]]

⥅ related node [[vladimir putin]]

⥅ related node [[warrant and proper function]]

⥅ related node [[web4]]

⥅ related node [[what]]

⥅ related node [[whatever]]

⥅ related node [[whattt]]

⥅ related node [[willigis jäger]]

⥅ related node [[withings]]

⥅ related node [[worlds hardest game]]

⥅ related node [[xenogenesis]]

⥅ related node [[xi jinping]]

⥅ related node [[yemen war]]

⥅ related node [[yoga with burup]]

⥅ related node [[zen of zig]]

⥅ related node [[zettelkastener]]

⥅ related node [[zhang yiming]]

⥅ related node [[zlibrary]]

⥅ related node [[ак 8476601 30]]

⥅ node [[1*]] pulled by Agora

📓 garden/flancian/1*.md by @flancian

⥅ node [[11]] pulled by Agora

📓 garden/flancian/11.md by @flancian

#pull [[right resolve]]

⥅ node [[119]] pulled by Agora

📓 garden/flancian/119.md by @flancian

[[Not a prime]], if you were wondering.
- [[17]] * [[7]]
- #pull [[seven Maitreyas]]

⥅ node [[13]] pulled by Agora

📓 garden/flancian/13.md by @flancian

In the [[Flancia]] [[Pattern Language]], 13 means [[Bodhicitta]] and [[Right Conduct]].
[[Gloria a las maravillas del universo]] is 13 syllables in Spanish.
[[If you lose your Bodhicitta, sit down and find it]] is [[13 syllables]] in English.

⥅ node [[131]] pulled by Agora

📓 garden/flancian/131.md by @flancian

a [[flancian]].
a [[prime]].

⥅ node [[17]] pulled by Agora

📓 garden/flancia.org/pages/17.md by @flancia.org

0 Glory be to the light of consciousness!

"Gloria a la luz de tu consciencia, [[Lady Burup]]!"

Y a todas las nuestras.

1 Flancia as a Pattern Language

After some investigation I've found Flancia resembles a [[Pattern Language]]. This is its index.

Flancia can also be thought of as a [[Mind Palace]] encoded numerically, with a focus on prime numbers and their composition into compounds.

2 Fork

As we fork we'll merge, as we meet we'll part, as we flow we'll [[focus]] (5).

An [[action]]. Fork a thing, a thought, a work of art or a piece of software.

Fork yourself if you want to. You can try to fork yourself into two versions with slightly different sets of beliefs, for example. You do this every time you consider both viewpoints in a debate.

3 Merge

As you [[fork]], you can [[merge]]. But I'm getting ahead of myself.

4 2,2 Fork, Fork.

Two things, in succession, or compounded.

A square, as one you draw or one you visualize while you breathe.

Maybe sometimes counting. Optionally factoring, optionally remembering things.

(Breath is the palace of the Buddha.)

5 Focus

"As we [[fork]] we'll [[merge]], As we [[merge]] we'll [[focus]]. As we [[flow]] we'll focus."

Whose recursive application may be seen to lead to [[Flow]] (25) and [[Flow with Compassion]] (35):

6 2,3 As we fork we'll merge

"As we flow we'll merge, As we merge we'll fork."

"As we fork we'll merge, As we merge we'll flow."

In the default number-based memory palace in the Agora of Flancia 2 means [[fork]], 3 means [[merge]]. 2 followed by a 3 make me think of [[flow]], as in [[yoga]], which is why in [[6]] I keep [[Yoga with X]] (the project.)

7 Avalokitasvara, or the [[Commons]] of [[Compassion]]

And why we'll be [[monks in space]]:

As we flow we'll burn, As we burn we'll warm and glow.

Like a rainbow folding, Like Maitreya burning."

[[Avalokiteshvara]] is seven syllables, but their mantra has six: [[Om Mani Padme Hum]].

This also contains the [[Commons]] (which should be run with [[Compassion]], and here we explore in the shape of an [[Agora]].)

8 2,2,2 The Eightfold Path

The Gautama Buddha found it, and before and after him others.

9 3,3 May you be happy!

May you be free from suffering!

10 2,5 Right View

11 Right Resolve

"Ay! Quién fuera Una flecha derecha Volando hacia el corazón de [[Moloch]]."

12 2,3,2 Right Speech

13 Right Conduct

14 2,7 Right Livelihood

15 3,5 Right Effort

16 2,2,2,2 Right Mindfulness

17 Right Concentration, or One Maitreya

18 3,3,2 May you be free from suffering!

"As we fork we'll merge and merge."

19 The Revolution

20 2,5,2

21 3,7 Building bridges

22 2,11

23 [[Lady Burup]]

24 2,3,2,2

25 5,5

Focus sequenced, squared, composed; [[Flow]].

26 2,13

27 3,3,3 May you be happy!

28 7,2,2 Four [[Commons]], Four [[Bodhisattvas]]

29 Drishti

Where is my [[light]]? Where is my [[focus]]?

30 2,3,5 As we fork we'll focus, we'll [[merge]]

"As we [[fork]] we'll [[merge]], As we [[merge]] we'll [[focus]]."

31 Las Jaras

Idiosyncratic. It happened to me: I found a card lying on the grass in a park, and it answered a question I had asked.

Also the highest number you can count up to with one hand if you use binary encoding.

32 2,2,2,2,2

Maybe fork and keep forking, like a [[fork]] reactor (not a bomb).

Fork five times while thinking of your [[focus]].

33 3,11

Merge our Right Resolves.

34 17,2 [[Dos Maitreyas]]

Fork Maitreya, you get [[Two Maitreyas]].

📓 garden/flancian/17.md by @flancian

a [[number]].
- #pull [[maitreya]]
a [[document]].
- #go https://docs.google.com/document/d/1kM6ZjIhqVgobJNAUldqqvGABs9pNovQ8vRGpa9ij120/edit?tab=t.0

⥅ node [[173]] pulled by Agora

📓 garden/flancian/173.md by @flancian

A [[prime]].
- #drishti [[29]] * 173 = [[5017]]

⥅ node [[197]] pulled by Agora

📓 garden/flancian/197.md by @flancian

a [[prime]], I'd [[wager]].
- popular on my [[mighty]], like [[191]] [[193]] [[197]] [[199]] :)
- [[agora plan]]:
  - Make [[#]] pull [[prime/#]] and [[hex/#]] and all other [[action]] nodes that seem number-relevant

⥅ node [[1c3]] pulled by Agora

📓 garden/flancian/1c3.md by @flancian

1c3

⥅ node [[22]] pulled by Agora

📓 garden/flancian/22.md by @flancian

~ two [[right resolves]]
#push [[pull]]
- #pull [[push]]

⥅ node [[249]] pulled by Agora

📓 garden/flancian/249.md by @flancian

249

a [[person]]
- [[friend]]
- [[twitter]] https://twitter.com/Xin0XZ

⥅ node [[25]] pulled by Agora

📓 garden/flancian/25.md by @flancian

[[5]] [[5]]

⥅ node [[27]] pulled by Agora

📓 garden/flancian/27.md by @flancian

#push [[loving kindness]]
- [[27]] = 3 * #3 * [[3]]
- 3 = [[merge]]
- 9 = 3 * 3 = [[may you be happy]]
- 18 = 3 * 3 * 2 = [[may you be free from suffering]]
- 27 = 3 * 3 * 3 = 3 ^ 3 = [[may you be happy]]
- [[54]] = 3,3,3,2 = [[may you be free from suffering]]
- [[…]]

⥅ node [[29]] pulled by Agora

📓 garden/flancian/29.md by @flancian

a [[prime]].
- [[drishti]] in [[braids]]

⥅ node [[2c]] pulled by Agora

📓 garden/neil/2c.md by @neil

2C

⥅ node [[30]] pulled by Agora

📓 garden/flancian/30.md by @flancian

[[2]] [[3]] [[5]]
- "as we [[fork]] we'll [[merge]] our [[lights]]"

⥅ node [[301]] pulled by Agora

📓 garden/flancian/301.md by @flancian

301

[[HTTP]] 301: Moved Permanently.
- the following is [[not true]]:
  - I use it throughout the Agora to point out that some variation of an entity (partial name; different case; etc.) should point to a different, canonical, node.
  - e.g. [[piglia]] 301s to [[ricardo piglia]].

⥅ node [[311]] pulled by Agora

📓 garden/flancian/311.md by @flancian

is it a prime, I wonder?
- https://anagora.org will tell me :D -> [[prime/311]] means https://anagora.org/prime/311 by default

⥅ node [[37]] pulled by Agora

📓 garden/flancian/37.md by @flancian

#go https://www.lotsawahouse.org/tibetan-masters/gyalse-thogme-zangpo/37-practices-all-bodhisattvas

⥅ node [[3ir]] pulled by Agora

📓 garden/neil/3ir.md by @neil

3IR

[[third industrial revolution]]

⥅ node [[3np]] pulled by Agora

📓 garden/flancian/3np.md by @flancian

3np

A [[person]].
[[hn]]

⥅ node [[3wc]] pulled by Agora

📓 garden/flancian/3wc.md by @flancian

a [[person]].
- [[friend]].
- [[they/them]]

⥅ node [[404]] pulled by Agora

📓 garden/neil/404.md by @neil

404

You seem to have been linked to a page that doesn't exist.

Sorry about that. Sometimes pages go AWOL in my garden.

Try visiting the [[homepage]] to get back on track.

⥅ node [[406]] pulled by Agora

📓 garden/flancian/406.md by @flancian

a [[number]].
- Significantly harder to factor than [[405]], which I find interesting.
- I think the fact that 405 and 406 are adjacent in the number line and have wildly differing difficulties of factorization probably says something about the nature of numbers? analyzing this fact can probably lead to interesting relations
- [[203]] * 2 but then I'm stumped, 203 could be a prime. I hope it is, maybe?
- It's clearly not divisible by 3 if you already checked [[406]] (sum of digits 10, not divisible by 3), but I still checked out of custom. While doing this, remembering which numbers you don't have to check is useful as it prevents duplicate work. Still I'm not concerned about repeating checks because I enjoy them.
- There is a bound for possible divisors we have to check; the bound is the square root of 203. That means that we may have gained some equity by not having taken the square root of 406, potentially harder to calculate than that of 203.
- In this case, though, the square root of 400 comes easier (to me): 20.
- But because we need to check divisors, we'll want the tighter bound. 203 can't be divisible by 5, can it be divisible by 7?
- 7 * 17 is 119, I know because they are my favourite numbers -- is this useful? It tells me that in 203 ?= 7 * [[x]], X is bound to be lower than 34.
- Then it occurs to me 210, which is near 203, is clearly 7 * 30 because 21 is 7 * 3.
- And lo and behold, 210-203 is 7 :) So we got our answer:
- [[203]] is [[7]] * 29]]
- [[406]] is [[2]] * [[7]] * [[29]]
- Beautiful!

⥅ node [[476]] pulled by Agora

📓 garden/flancian/476.md by @flancian

One [[Maitreya]] and four [[Avalokiteshvara]] :)

⥅ node [[4ir]] pulled by Agora

📓 garden/neil/4ir.md by @neil

4IR

[[Fourth Industrial Revolution]].

⥅ node [[55]] pulled by Agora

📓 garden/flancian/55.md by @flancian

[[5]] [[11]]
an [[app]]
- #go https://prod.d3p2umbd3rzvv9.amplifyapp.com/
  - -> https://anagora.org/go/55

⥅ node [[5g]] pulled by Agora

📓 garden/neil/5g.md by @neil

5G

10 Gbit/s?

⥅ node [[67]] pulled by Agora

📓 garden/flancian/67.md by @flancian

[[light]] in the [[Flancia]] pattern language.

⥅ node [[79]] pulled by Agora

📓 garden/flancian/79.md by @flancian

#pull [[Sadhana]]
- I was unsure what number I had associated it with, but today I saw it in the whiteboard.
- It was the first prime that seemed "available" on a certain date :) And I think it still is; next up [[83]] is yours truly (as I was born on that year), then we only have [[89]], [[91]] and [[97]] left before the hundreds.

⥅ node [[84k]] pulled by Agora

📓 garden/neil/84k.md by @neil

84K

by Claire North
saw it on Ton's list - https://www.zylstra.org/blog/2019/08/84k-by-claire-north/

From a review on Kobo:

Gripping dystopia view into the near future. Bound by love for friends and family amongst the ruins of [[corporate takeover of the social system]].

https://www.kobo.com/gb/en/ebook/84k-3

Sounds right up my street.

I started reading it last night and am liking it already. The writing style has grabbed me.

So far, there is an ambulance service that requires a subscription, and 'voluntary' team building that you have to pay for, and docked pay if you don't go.

Although I read it a long long time ago, for some reason 84K put me in mind of [[Catch-22]]… I guess the sense of odd characters trying to get by in a world of generally accepted absurdity.

-—

Still reading through and very much enjoying [[84K]]. One of best books I've read for a while, so far. It's a really unconventional writing style, and it's great. Very poetic. A refreshing change to that kind of generic stilted cyberpunk patter you get in a lot of near-future fiction.

It's a pretty sad book though. It's somewhere between [[Kafka]], [[Brazil]] and [[1984]]. The way it captures some of the potential awfulness of a fully corporatised society, I find it much more depressing than a lot of the cyberpunk dystopias. Cultural hegemony is much more terrifying than a cabal of bad guys.

-—

I finished 84K a few days back.

Loved it. It was both a page-turner and fantastically written. A very unique style.

Also grim, sad, and sitting in that disconcerting place of being far-fetched but also not so far from the current truth.

I think I would probably read it again - I feel like I'd discover a second layer of enjoyment a second time through. Which is a sign of a good book for me.

I think I would probably read it again - I feel like I'd discover a second layer of enjoyment a second time through. Which is a sign of a book that'll be a long-time favourite for me.

Some things that will stick in my head - the patty-line. Ragers. Sponsored towns.

Finished it June 2020.

—

[[Neoliberalism]].

⥅ node [[97]] pulled by Agora

📓 garden/flancian/97.md by @flancian

[[Magnetic launchers]]
[[Magnets]] in general?
- (I associate concepts to numbers (mostly primes, but not always) as a mnemonic device and practice -- see [[Flancia pattern language]] for more.)
- (I found this concept near both 79 and 97 in a whiteboard.)

⥅ node [[abs]] pulled by Agora

📓 garden/neil/abs.md by @neil

ABS

acrylonitrile butadiene styrene

Like almost every form of plastic on the planet, ABS is made from petrochemicals that are derived from petroleum, the fossil fuel we commonly refer to as crude oil. The substance materialized over millions of years as fossilized organisms like zooplankton and algae were covered by stagnant water and further layers of these dead animals and plants. Try to imagine not only how slow that process is (geologists call this “deep time”) but also the near-instantaneous speed at which the oil was extracted from the earth. Now consider its carbon residue just sitting in the atmosphere, slowly helping make the planet hotter. As I stared at the plastic, these head-spinning thoughts flashed through my mind.

– [[The environmental impact of a PlayStation 4]]

⥅ node [[ack]] pulled by Agora

📓 garden/flancian/ack.md by @flancian

an [[agora action]]
- [[ack]] is a complement to [[push]]. node b can [[ack]] an incoming push from node a, then it gets "silenced".
- [[receive]] is another complement.

⥅ node [[add]] pulled by Agora

📓 garden/flancian/add.md by @flancian

ADD

See also: [[ADHD]]
- I wonder if I have it.
- https://twitter.com/flancian/status/1416445117376966658

Project

Read [[Driven to Distraction]]
Read [[Scattered Minds]] Reminder: [[2020-10-05]] [[2020-10-10]]

⥅ node [[ag]] pulled by Agora

📓 garden/flancian/AG.md by @flancian

a [[person]].
- my [[love]].
- also a [[friend]].
- We texted each other on Bumble on the 27th of March of 2023.
- We met on the 30th of March, went to [[Xenix]] and [[Ikoo]], exchanged numbers on the 31st.
- We had tea on the [[2nd of April]].
- Her birthday is on the [[11th of June]].

We met as we were nearing the 0th of April and it was meeting beauty from the start.

We travelled apart for three weeks in the first six weeks, but we kept in touch and longed for each other, I am fine asserting, although I have direct experience only of my longing for her.

I went to the May 1st activities thanks to her. We drank fresh mint tea; we will read for each other.

[[2023-06-11]]
[[2023-07-04]]
and so many more :)
[[2024]]

⥅ node [[agi]] pulled by Agora

📓 garden/neil/agi.md by @neil

AGI

⥅ node [[ahs]] pulled by Agora

📓 garden/flancian/ahs.md by @flancian

ahs

[[pull]] [[annotated-hub-of-science]]
[[hub]]
- [[components]]
  - [[hillel]]
    - [[p2p repository]]
    - its storage aspect could be [[ipfs]]
    - plus [[fatcat]]?
    - authors could give copies directly to specific people that interested in them, which is usually allowed by contracts with publishers even when open web publishing is forbidden by terms
  - [[starling]]
    - searching for a paper could be seen as an intent by a reader to get a paper; and authors could set the system up to auto-share with interested people
    - starling is a [[mechanism]]
  - [[summaries]] (unnamed)
  - [[web annotations]] could
pending names :)
- one for the [[mechanism]] for summarization -- [[distil]]?
- I can't believe it's not (...) -- [[synthesize]]?

⥅ node [[ai]] pulled by Agora

📓 garden/neil/ai.md by @neil

AI

My problems with AI as it currently stands:

AI uses a huge amount of natural resources
AI is controlled by a small number of tech companies

Basically planetary boundary issues and social equity issues.

⥅ node [[aim]] pulled by Agora

📓 garden/flancian/aim.md by @flancian

aim

[[pull]] [[goals]] [[tagline]]

⥅ node [[aka]] pulled by Agora

📓 garden/flancian/aka.md by @flancian

Aka

An [[action]].
Designates a node as a synonym of another.
- [[USA]] [[aka]] [[united states]]
Can take a single parameter to alias the current node with the target.
- [[aka]] [[also known as]]

⥅ node [[aly]] pulled by Agora

📓 garden/s5bug/aly.md by @s5bug

Aly

A [[person]].
My [[self]].
[[Matrix]] @aly:scuttlebug.space
[[pull]] [[s5bug]]

⥅ node [[ama]] pulled by Agora

📓 garden/flancian/ama.md by @flancian

Ama

[[pull]] [[ask me anything]]
I sometimes do AMAs on [[twitter]]: https://flancia.org/t/ama.

⥅ node [[an]] pulled by Agora

📓 garden/flancian/an.md by @flancian

An

An [[indefinite article]].
A [[person]].
- #twitter https://twitter.com/anthemaker
- #founder [[spacehey]]
- Just 18 years old as of [[2021-01-10]].

⥅ node [[ana]] pulled by Agora

📓 garden/flancian/ana.md by @flancian

ana

una [[persona]].
- [[amiga]].

⥅ node [[anu]] pulled by Agora

📓 garden/flancian/anu.md by @flancian

Anu

[[pull]] [[australian national university]]
[[go]] https://www.anu.edu.au/

⥅ node [[ap]] pulled by Agora

📓 garden/flancian/ap.md by @flancian

a [[person]].
- [[friend]]
- [[catalan]]

⥅ node [[apl]] pulled by Agora

📓 garden/flancian/apl.md by @flancian

apl

a [[programming language]].
- see also [[BQN]]
a [[book]].
- #read [[a pattern language]]
- #go https://anagora.org/go/a-pattern-language/hypothesis

📓 garden/melanocarpa/apl.myco by @melanocarpa

APL is an array-oriented programming language, or rather a family of such languages. APL was originally a [[math notation]], but because it was a good math notation, it naturally transformed into a programming language. Its most known feature is a vast usage of made-up characters and extremely compact programs.

A notable descendant of APL is [[BQN]].

= Links => https://wordsandbuttons.online/apl_deserves_its_renaissance_too.html | APL deserves its renaissance too

life←{↑1 ⍵∨.∧3 4=+/,¯1 0 1∘.⊖¯1 0 1∘.⌽⊂⍵}
I know, I know. I should have started with the introduction. But doesn’t it introduce itself rather well? You can see for yourself that it’s ultimately concise, expressive and utterly alien to all the mainstream computer languages.

=> http://archive.vector.org.uk/art10011550 Чувак доказывает, что APL круто

⥅ node [[ar]] pulled by Agora

📓 garden/KGBicheno/Artificial Intelligence/Introduction to AI/Week 3 - Introduction/Definitions/Ar.md by @KGBicheno

AR

Go back to the [[AI Glossary]]

Abbreviation for augmented reality.

⥅ node [[as]] pulled by Agora

📓 garden/flancian/As.md by @flancian

The following was written by [[Lady Burup]]:

eeeeedvffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff´[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[ n37

⥅ node [[ask]] pulled by Agora

📓 garden/flancian/ask.md by @flancian

Ask

⥅ node [[b-]] pulled by Agora

📓 garden/flancian/b..md by @flancian

le está yendo bien con el nuevo (viejo) medicamento

⥅ node [[b-a]] pulled by Agora

📓 garden/flancian/b a.md by @flancian

B. A.

Horas por semana: 31 (7 cursos).. Antes llegó a trabajar 54.
Pagan: 40 por el bachillerato internacional.
Horas extra: 10 horas por semana en promedio; corregir, preparar.

⥅ node [[bar]] pulled by Agora

📓 garden/flancian/bar.md by @flancian

Bar

⥅ node [[baz]] pulled by Agora

📓 garden/flancian/baz.md by @flancian

baz

[[foo bar]] https://flancia.org

⥅ node [[be]] pulled by Agora

📓 garden/flancian/be.md by @flancian

#pull [[do]] [[want]]

⥅ node [[bp]] pulled by Agora

📓 garden/neil/bp.md by @neil

BP

⥅ node [[bqn]] pulled by Agora

📓 garden/flancian/BQN.md by @flancian

a [[programming language]]
- "an [[apl]] for your flying saucer"

⥅ node [[buy]] pulled by Agora

📓 garden/flancian/buy.md by @flancian

Buy

A list of things I mean to buy.
An [[action]].
See [[do]].

⥅ node [[c2]] pulled by Agora

📓 garden/flancian/c2.md by @flancian

C2

a [[wiki]].
- The [[OG]]
- [[go]] https://wiki.c2.com
  - [[pull]] [[wikiwikiweb]] [[patterns]] [[wiki modes]].
- #og https://kidneybone.com/c2/wiki/WikiWikiWeb
  - this is a read only mirror that I like
- by [[ward cunningham]]
  - and a [[wiki community]]
a [[firm]].
- [[consultancy]] [[ward cunningham]]
- known to me for hosting the above.

⥅ node [[c5n]] pulled by Agora

📓 garden/flancian/c5n.md by @flancian

#go https://www.c5n.com/vivo

⥅ node [[cal]] pulled by Agora

📓 garden/flancian/cal.md by @flancian

a [[service]].
- helps you and the people who want to meet with you manage your calendar.
- #go https://cal.com/flancian

⥅ node [[cat]] pulled by Agora

📓 garden/flancian/cat.md by @flancian

Cat

An [[animal]].
- [[ocell]].
A [[person]].
- [[mastodon]] https://pinafore.social/accounts/187732

⥅ node [[ccr]] pulled by Agora

📓 garden/flancian/ccr.md by @flancian

#go [[coop cloud recipes]]
#push [[agora plan]]
- Fix [[ccr]], meaning implement [[indirect go links]] (across nodes)

⥅ node [[cia]] pulled by Agora

📓 garden/neil/cia.md by @neil

CIA

⥅ node [[cla]] pulled by Agora

📓 stoa/doc.anagora.org/cla.md by @anonymous@doc.anagora.org

⥅ node [[cli]] pulled by Agora

📓 garden/bmann/_notes/cli.md by @bmann

Various Command Line Interface tips and tricks

Some of the things at [[Ubuntu]] are Ubuntu Linux specific, some of them will work on other systems, including in the MacOS Terminal.

lsof

lsof -i :8080

Will list what's running on port 8080.

Looking up the process ID (PID) means you can get more info, or kill [PID] to shut it down.

📓 garden/flancian/cli.md by @flancian

CLI

[[pull]] [[command line interface]]

📓 garden/vera/cli.md by @vera

[[command-line]]

⥅ node [[cop]] pulled by Agora

📓 garden/neil/cop.md by @neil

COP

Conference of the Parties.

Parties being nations.

⥅ node [[cow]] pulled by Agora

📓 garden/flancian/cow.md by @flancian

cow

a [[being]].
- [[conscious]] (seems like to me)
- [[yoga]] [[cat]]

⥅ node [[crm]] pulled by Agora

📓 garden/neil/crm.md by @neil

CRM

Can you use (and do I want to?) org as a CRM?

⥅ node [[css]] pulled by Agora

📓 garden/jakeisnt/pages/css.md by @jakeisnt

Cool tricks with CSS.

Convention

Don't use Margin

Don't use Margin Margin breaks component encapsulation because components impact everything surrounding them and external to them. It also makes reusability difficult and impacts external components. The stack component, similar to other spacer components, is useful for adding arbitrary spaces internal to and external from different components. THese help define discrete units for space as well which can be standardized across the application.

Computation

CSS can do a lot more than we use it for: it can count, for one.

Vulnerabilities

saizai/cssfingerprint: a research project to see how well the CSS history hack can fingerprint a user

Do not blindly copy paste

source In this code segment, it's trivial to hide the truth of the text that's being copied, thus resulting in a blind paste into terminal being malicious:

<style>
span {
    font-family: monospace;
    position: absolute;
    color: white;
    cursor: text;
}
span::selection {
    background: #accef7;
    color: #accef7;
}
span::before {
    content: "clip";
    position: absolute;
    color: black;
}
</style>
<span>silly</span>

One way the author recommends safe pasting is via this command:

alias prepaste='builtin fc -e "vim -c %d -c \"set paste\""'

This opens the line pasted in vim before sending it to the browser, encouraging you to preview and edit it.

Alignment tricks!

Ten modern layouts in one line of CSS

Transform

transform() operations occur outside of the flexbox algorithm, so things can be displayed with flexbox then instantly transformed to their proper position as desired. This also allows us to place an element entirely out of the document flow! (adding a 'close' button, for example).

⥅ node [[cut]] pulled by Agora

📓 garden/melanocarpa/quadrat_04/cut.jpg by @melanocarpa

⥅ node [[cwg]] pulled by Agora

📓 garden/flancian/cwg.md by @flancian

a [[working group]].
- #pull [[social coop]] [[community working group]]
- #meet https://socialcoop.meet.coop/mat-ivs-47b-bbp
- #oncall https://share.mayfirst.org/apps/calendar/p/KG92DPwX3ww442AD/dayGridMonth/now
- #go https://www.loomio.com/socialcoop-community-working-group/
- #bugs https://git.coop/groups/social.coop/community/-/issues
- [[minutes]] https://www.loomio.com/d/yh0aFRbU/community-working-group-ops-team-minutes
- [[onboarding]] from [[sam whited]]
  - [[registrations]] overall
    - shared [[zoho]] inbox for registrations
    - check https://git.coop/social.coop/community/operations/-/issues for open issues, although the [[spam trap]]; can ignore meet.coop registrations
      - example: https://git.coop/social.coop/community/operations/-/issues/633
      - check open collective user exists; check it's not obviously spam
      - use labels to track workflow (spam, in progress, approved)
      - we wait for the next two oncalls, then we close as non responsive
  - [[loomio]]
    - most people don't apply to loomio; most people don't do this unfortunately (yet?)
    - but we have to approve applications to the organization as well
    - now I'm an admin so I should get emails about new approvals pending
    - approve if legit and maybe set a social.coop "flair"
  - [[misc]]
    - check admin@social.coop for activity (have it logged in in a separate window)
    - maybe post once or twice a week
      - size of instance
      - nudge people to go to loomio
    - moderate mastodon instance as needed
- see also [[twg]].

📓 stoa/doc.anagora.org/cwg.md by @anonymous@doc.anagora.org

⥅ node [[d-p]] pulled by Agora

📓 garden/flancian/d p.md by @flancian

D. P.

A [[person]].

⥅ node [[d3]] pulled by Agora

📓 garden/flancian/d3.md by @flancian

d3

[[go]] https://d3js.org/

⥅ node [[dag]] pulled by Agora

📓 garden/flancian/dag.md by @flancian

Dag

See also: [[directed acyclic graph]].
[[go]] https://en.wikipedia.org/wiki/Directed_acyclic_graph

📓 garden/vera/dag.md by @vera

⥅ node [[dai]] pulled by Agora

📓 garden/flancian/dai.md by @flancian

#pull [[diana]]

⥅ node [[dao]] pulled by Agora

📓 garden/neil/dao.md by @neil

DAO

[[decentralized autonomous organisations]]

📓 garden/vera/DAO.md by @vera

Start a DAO

⥅ node [[dat]] pulled by Agora

📓 garden/neil/dat.md by @neil

dat

📓 garden/unrival/environment/technology/dat.md by @unrival

A distributed data community for the next generation Web.

A protocol for assigning and interpreting content-based addresses.

https://dat.foundation/

⥅ node [[day]] pulled by Agora

📓 garden/flancian/day.md by @flancian

Day

A period of roughly [[24 hours]].
An [[era]] or [[period]].

⥅ node [[dbt]] pulled by Agora

📓 garden/bmann/_notes/dbt.md by @bmann

Data Build Tool

a command line tool that enables data analysts and engineers to transform data in their warehouses more effectively. Today, dbt has ~850 companies using it in production, including companies like Casper, Seatgeek, and Wistia. -- What, exactly, is dbt?, Tristan Handy, Oct 2017

From the same article:

dbt code is a combination of SQL and Jinja, a common templating language used in the Python ecosystem. ref() is a function that dbt gives to users within their Jinja context to reference other data models. ref() does two things:

It interpolates itself into the raw SQL as the appropriate schema.table for the supplied model.

It automatically builds a DAG of all of the models in a given dbt project.

Both of these are core to the way that dbt operates. Because dbt is interpolating the locations of all of the models it generates, it allows users to easily create dev and prod environments and seamlessly transition between the two. And because dbt natively understands the dependencies between all models, it can do powerful things like run models in dependency order, parallelize model builds, and run arbitrary subgraphs defined in its model selection syntax.

⥅ node [[dej]] pulled by Agora

📓 garden/flancian/dej.md by @flancian

Dej

[[2021-06-19]]

check in
- [[army of love]]
  - 4h today, 4h tomorrow
- [[armengol]]
  - working on documentation for [[pointless]]
  - doing lots of video editing, learning as we go
  - in the style of youtube videos / clickbait aesthetic
- [[color encodings]]
  - [[jab]]
  - [[hccb]]
  - [[josh rowell]]
- summarizing the intro of [[a pattern language]]
[[agora]]
- [[agora polls]]
- [[python]] vs [[javascript]]

[[2021-06-05]]

how to translate between conventions
[[agora protocol]]
- [[agora trees]]

[[2021-05-22]]

[[operands]]
- [[nested systems]]
- [[category theory for engineers]]
  - https://applied-compositional-thinking.engineering/
  - https://vimeo.com/551804154
[[intentions]] -- things we wanted to do but haven't done yet
- [[lorand]] wanted to write more notes on [[notes on synthesis of form]]
  - with the intention of sharing in github space
  - and practicing merging algorithms
- we could also do this for [[a pattern language]] and this week's "homework":
  - introductory material at the front of the book
  - then each person chooses a pattern to share
- decision
  - let's do this first for a pattern language
  - but also keep on trying with notes
other [[topics]]
- recap of conversation on [[2021-05-08]]: notes in [[armengol]].
  - [[context]]

[[2021-04-24]]

[[jonathan]] busy, lots to read for the masters
- now in the gallery scene ;)
[[armengol]] also busy, probably need a break
- [[workaholic mode]]
- sometimes feels like he's "lost the ability to have fun"
- [[2h30m]] away from [[barcelona]]
- when he goes he ends up meetings lots of people in a cluster/sequence
- (reminded me of my visits to buenos aires)
- when you're working too much, it's easy to become less efficience/diverge
- exploratory mode?
[[topics]]
- [[jonathan]] is there a simple way to get a git repository of markdown notes?
  - [[flancian]] [[kaleido]] is looking nice!
  - [[reading alexander]] repository could be an experiment
    - [[two modes]] at least:
      - conversation mode
      - [[do]]
        
        shared document mode
        
        [[priority]]
    - nice thing about [[etherpad]] in an activity yesterday is that it can be ephemeral; it can be unstructured; it can have structure
- ui / ux experiments
- [[roadmap]]
  - [[goals]] plus [[timeframes]]
  - see notebook
- [[push]] [[do]]
  - incorporate reading alexander into the agora
- [[armengol]] how did you manage taking notes for [[reading alexander]]?
  - [[jonathan]] mostly on paper; tried transferring later but couldn't make the time

[[2021-04-03]]

Vacaciones vs trabajo en modo freelance
[[push]] [[pointless]]
- two weeks ago
- video on twitch
- edited version is coming
[[bitcoin]] -> altcoins -> ethereum -> [[icos]]
- [[nfts]]
  - [[armengol]] gran potencial económico para muchos artistas
[[walter benjamin]]
- [[the work of art in the age of mechanical reproduction]]
[[hannah arendt]]
how to store [[context]] to recover mind states in the relatively distant future?
how do you handle todos/projects?
- [[jonathan-the-utopian]]
  - [[todoist]]
  - journaling in [[obsidian]]
encoding information in [[dna]]
[[recording app]]
- Why Would A Recording App Win “Best App of the Year”?: https://www.youtube.com/watch?v=TtfdWl10lN4
[[now]]: https://sive.rs/nowff
[[agora]]
[[jekyll]]
[[jonathan-the-utopian]] thesis update
- formats for groups processes
- have been participating in workshops
- doing reading
  - [[roland barthes]]
  - [[hannah arendt]]
  - [[christopher alexander]]
  - [[non violent communication]]
  - [[victor papanek]]
- structuralism and vulnerability
  - [[structure]], [[understanding]], [[interface]]?

[[2021-03-06]]

https://anagora.org/go/meet
- [[virtual spaces]], [[meeting points]], [[schelling point]]
- recuerda a [[discord]] y sus salas de voz
- what [[clubhouse]] is trying to exploit
[[meeting points]]
- [[zurich]] flea market in [[helvetiaplatz]]
- [[ritual]], going to a bar every second friday -- associated bar
[[big blue button]]
- [[meet.coop]]
  - [[social.coop]] gets this at some tier
[[beeper]]
- could be a [[coop]]?
- jailbroken iphones: a joke?
[[ghost]] publishing, some of the profits
- [[write freely]]
[[foam]]
- [[governance]]
- c.f. [[athens]]
[[ctzn]] is broken
- ctznry.com
[[agora]] governance
- users control it by coding nodes however they can
- users control it by proposing changes to its contract
- users control it by forking and merging agoras
  - it should be one command essentially
- [[jonathan]]
  - difference in skill between users means difference in power
  - power is held by people who host?
    - yes, I agree. reducing this power, making it easy to host, is a priority.
- two [[threads]]:
  - what is stimulating from this vision
  - reflecting on the dangers
how did the presentation for the masters go?!
- a lot of the discussion that happened with the jury, in particular a philosopher, was centered around
- "this project seems like it's situated in [[social design]] and it's important to read works in this space, concerning in particular to risks"
- western / colonial gestures / white saviour complex
[[armengol]] the problem of getting things into [[shareable]] state
- [[flancian]] defaults to sharing all :)
  - [[armengol]] tries to understand why he wants to say something, what's behind it; to process, filter, etc.
- example problem: where should we meet after this? been thinking about [[coordination problems]]; how we relate to [[digital information]].
- thought about [[rules]] and [[principles]]
  - [[aside]] [[contract]], [[devine-lu-linvega]]'s [[a cheatsheet on discourse]]
  - [[identity principle]] -- in a digital context you are your information as shared in the [[digital ecosystem]]
  - [[fashion]]
    - [[barthes]]
- if we are planning on sharing a [[space]], imposing [[rules]] can be a form of [[violence]]; you are limiting and bending other people's identities
  - rules for the self converges to [[free will]]
- [[principles]] are a common understanding of something. they can be used in subsets with a purpose.
  - principles could be in [[contract]]
  - when people interact, they try to follow all [[contracts]]
- [[a cheatsheet on discourse]]
  - three gates
    - [[is it true]]
      - relevant principles:
        
        there is no absolute truth
        
        reality can be described from many valid subjective perspectives
[[push]] [[armengol principles]] based on our relationship with information in a digital context
- [[identity]]
  - [[you are your information as manifested]]
- [[individuality]]
  - [[each individual has different needs]]
- [[linkage]] (connectivity?)
  - [[we are a network]]
- [[contract]] (spatiality?) (commonality?)
  - [[communication]] is only possible when you share common spaces
    - (discussion about definitions of space and communication here)
    - [[do]] discuss [[communication theory]]
- [[origin]] (synchronicity?)
  - every piece of information has been created at a moment in time
- [[accumulation]] (historicity?)
  - you can not change the past -- append only
- [[meaning]] (diachronicity?)
  - you can only connect the dots looking backwards
[[push]] [[armengol rules]]
- we are used to working with markdown. it functions as a common space; it is not just the file, but the associated systems to deal with the files and link them.
- what if we have a place where we can work together on these files.
  - [[stoa]]?
- if we override the words of others, this is invasive. but if we don't agree on a shared context, communication cannot happen.
- [[aside]] [[m prime]]

📓 garden/jonathan/DEJ.md by @jonathan

Meetings

[[2021-05-22]]
- still want to write NoTSoF
  - make for a pattern language FIRST
- intention to merge our notes once we've made them
- for reading group on wednesday wanted to choose patterns
  - use repository
- TO Dos
  - summary of introduction of Pattern Language
  - start brainstorming list for glossary of terms fo NoTSoF (or more general [[Christopher Alexander]]), write these into the [[Agora]]
- them telling me some things from their last conversation
  - regarding information and context
    - how to understand what others understand, as regards context
    - how to see if we are on the same page
    - sometimes one spends a lot of time of doing things, but one doesn't realize one is not using the same concepts/ideas for a given term
    - how to determine a minimum set of concepts/tools to check understanding -> a "conceptual context"
    - what can a "minimum denominator" be in understanding that can be a common ground / context
    - how to deal with context question
      - including passing a text, passing materials to share one's own context
      - procedures to assemble a context
      - procedures to check if we have the same context
        
        e.g. in the agora, pooling materials around a node
- building bridges between conventions rather than
- the exercise we are doing is about assembling different points of view on a single given topic
[[2021-04-24]]
- Topic one: moving/experimenting towards a shared digital garden?
  - D: there are two things to distinguish
    - shared garden for sharing notes
    - discussion/threading/chat space
  - J: let's focus on the shared notes thing first
Links
- twitter but more user controlled ?
  - https://joinmastodon.org/
  - https://ctznry.com/
- the original wiki: https://wiki.c2.com/
- an neat threaded hypertext project: https://www.kickscondor.com/HT2020/
- https://anagora.org/wiki-modes
[[2021-04-03]]
- [[Walter Benjamin]]
  - The work of art in the age of mechanical reproduction
- [[Hannah Arendt]]
  - Jonathan wants to probably read a bit about her "theory of action"
    - https://plato.stanford.edu/entries/arendt/#AreTheAct
- Copyright, Information laws, authorship, reputations, social capital
- https://en.wikipedia.org/wiki/Steganography
- memes don't have authorship
- why/when is authorship important?
  - recognition
- D thinks it would be interesting to apply the pattern language paradigm to understanding the nature of information and our interactions with it
- Luciana mentioning that information discussion reminded her of Derrida
  - maybe intellectual three to Bateson ?
  - key term for Derrida 'difference'
- E interested in definitions of information, information theory, etc
  - relation of information and power
  - seeing as a state
    - seeing people as information about them
- Now pages
  - https://sive.rs/nowff
- Idea of having one's own API
- Digital gardeners
  - Anne le-Cunff
  - Telegram chat
- Moa
  - integrating different streams/platforms of information
- Indie-web, RSS
- Indiekit
- Plan files
  - .plan format, writing what one is planning to do
- Carmack
  - famous programmer (doom, quake engines)
- Primer
  - movie, made with 10'000, indie sci fi
- Junkhead
  - https://www.youtube.com/watch?v=ge18Ieyi9bI&t=9s
- [[Adam Curtis]]
  - Can't get you out of my head
  - https://en.wikipedia.org/wiki/Can%27t_Get_You_Out_of_My_Head_(TV_series)
- Harun Farocki
  - https://en.wikipedia.org/wiki/Harun_Farocki
- J's MA project?
  - Structuralist vs. 'content/empotional/energetics' vs. UX aspects - maybe they form a trichotemy?
- Omega rule
  - extension of principle of charity ?
  - make effort to interpret what someone else is saying as if it makes complete sense
- Question about
  - https://twitter.com/flancian/status/1320054847987646469
[[2021-06-03]]
- https://www.beeperhq.com/
- https://ghost.org/
[[2021-02-14]]
- How we relate to [[information]]
- Thought connection to [[Christopher Alexander]]: systems that allow open-ended organic evolution
- ample -- seperation/distinction between [[modeling]] and [[coding]]
  - how to get people to communicate what they need
- m prime
- protopian themes will always lead to the word "good"
  - thinking of it as a "free variable"
  - ethics as fundmental thing to consider
    - always need to incorporate when we think/speak about how a system "should be"
    - lyotard
  - Daniel's (short-) story:
    - an overall theme to place here at the start: the back and forth interplay between technology and society
    - a short choronology
      - began studying mulimedia engineering, was attracted to playing with tech
      - first study program was a mix of computer science and design, but felt like a frankenstein program
      - he moved to a design university to continue his study path
        
        electronic art and digital design
      - got involved in touch-pad table project
      - this lead to being part of starting an UX design studio
      - in context of various projects became more interested the way people were interacting with digital projects/objects rather than on the content of those projects/objects
      - moved more into art
      - art was inspiring him and wanted to also inspire others
      - developed his own form of artistic practice
      - stopped working for brands
      - moved to the woods with a friend (call them X); X has more tech skill than D
      - together they started prototyping
        
        D more on the research part
        
        X on the tech part
      - D did a bootcamp to learn more of the tech tools
      - bounced back though to thinking more about the tools / human / interaction (??) side
      - trying to find balance
  - D: comment about how
    - artists "can do whatever they want"
      - society "accepts" this
      - D wants to have this freedom; doens't want to be an artist as a "job" or "unique role"
    - use of artistic techniques / practices as a medium
      - doing experiments
        
        is "playting", but in the adult context
      - exploring and sharing without restrictions
      - social space of creation
    - E: association with "carneval"
      - Art as a bargain
      - being "decoupled" from society ?
    - E: wants [[revolution]], not carneval
  - D: if he had to use a label (which he doesn't like), it would be that he works with "concepts" ("conceptual artist")
  - using art as a lens, a way of seeing
  - D: many people are asking similar questions to the ones we are asking/discussing
    - how to have these [[conversations]] with groups of people?
  - E: how to also enable new connection making ?
    - and how can groups have conversations among themselves (between groups)
      - [[liquid democracy]], delegates ?
  - E: info com
    - [[text adventures]] / [[interactive fiction]]
    - [[collaborative writing]]
    - [[conversation trees]]
  - E: interested in the spectrum between writing with natural languages and programming
  - D: broad current interest: information and the digital context
    - what are structurings of information that make it useful to me and others?
  - E: "[[Context]]" is a key concept
    - key problem in CS and [[information theory]]: the question of "state"
    - a way to think of context:
      - an intersection of [[world model]]s (e.g. between communicating parties), together with
      - [[transformations]] (i.e. ones we do in our minds), such as
        
        when translating terms in one's mind when someone else is speaking
        
        tracing paths of thinking (??)
        
        knowing who one is speaking/listening to and interpreting in this context
    - some things are able to be externalized as technical tools
      - if they are modularizable and can have an "interface" to interact and link up with
    - some things are somehow so entangled and enmeshed that it seems impossible to seperate them out from what happens in the mind and externalize them

⥅ node [[dev]] pulled by Agora

📓 garden/flancian/dev.md by @flancian

dev

a [[tld]]
- short for [[development]] or [[developer]]
a [[crypto token]]
- [[go]] devprotocol.xyz
- [[twitter]] twitter.com/devprtcl
- a token for open source funding and governance
[[agora]] http://dev.anagora.org

📓 garden/tilda/dev.md by @tilda

dev

sometimes i do programming on my free time. i was more active in the past but got kind of burnt out - so now i only work when i think of a new project most of the time.

my favorite languages

python for its simplicity and popularity

rust for its cool concepts and being a good way to break into systems programming

languages i dislike

javascript - even though i do frequently use it, it's just kind of awkward to use imo

⥅ node [[did]] pulled by Agora

📓 garden/flancian/did.md by @flancian

did

a [[convention]]
- a [[decentralized identifier]]
- [[pull]] [[dids]]
- [[go]] https://www.w3.org/TR/did-core/#a-simple-example

⥅ node [[dkg]] pulled by Agora

📓 garden/flancian/dkg.md by @flancian

Dkg

[[pull]] [[distributed knowledge graph]]

⥅ node [[dlt]] pulled by Agora

📓 garden/vera/DLT.md by @vera

Distributed Ledger Technology
#same-as [[blockchain]]

⥅ node [[dns]] pulled by Agora

📓 garden/flancian/dns.md by @flancian

dns

a [[system]].
- [[hierarchical]] [[decentralized]]
- [[domain name system]]
  - [[wp]] https://en.wikipedia.org/wiki/Domain_Name_System
a [[thing]].
- [[pull]] [[servers]] [[domains]]
- I use [[namecheap]].
- If you want to add a DNS record to anagora.org or flancia.org, for now please write to 0@flancia.org or open a github issue in [[go/agora]] with your request.

⥅ node [[do]] pulled by Agora

📓 stoa/doc.anagora.org/do.md by @anonymous@doc.anagora.org

⥅ node [[dog]] pulled by Agora

📓 garden/flancian/dog.md by @flancian

dog

[[go]] https://en.wikipedia.org/wiki/On_the_Internet,_nobody_knows_you%27re_a_dog

⥅ node [[doi]] pulled by Agora

📓 garden/flancian/doi.md by @flancian

doi

[[go]] doi.org

📓 garden/vera-logseq/pages/doi.md by @vera-logseq

digital object identifier
used as a global identifier for academic resources, most notably research papers
[[pull]] [[sci-hub]]
doi lookup
- https://www.crossref.org/guestquery

Backlinks

[[doi]]

Backlinks last generated 2022-01-28 07:55:20

📓 stoa/doc.anagora.org/doi.md by @anonymous@doc.anagora.org

⥅ node [[dqn]] pulled by Agora

📓 garden/KGBicheno/Artificial Intelligence/Introduction to AI/Week 3 - Introduction/Definitions/Dqn.md by @KGBicheno

DQN

Go back to the [[AI Glossary]]

#rl

Abbreviation for Deep Q-Network.

dropout regularization

A form of regularization useful in training neural networks. Dropout regularization works by removing a random selection of a fixed number of the units in a network layer for a single gradient step. The more units dropped out, the stronger the regularization. This is analogous to training the network to emulate an exponentially large ensemble of smaller networks. For full details, see Dropout: A Simple Way to Prevent Neural Networks from Overfitting.

⥅ node [[e2h]] pulled by Agora

📓 garden/flancian/e2h.md by @flancian

e2h

[[go]] https://e2h.totalism.org
- "e2h auto-generates html by transforming and styling [[etherpads]]"

⥅ node [[ea]] pulled by Agora

📓 garden/flancian/ea.md by @flancian

ea

[[ea forum]]
- [[go]] https://forum.effectivealtruism.org/

⥅ node [[ec]] pulled by Agora

📓 garden/flancian/EC.md by @flancian

a [[person]].
- [[Elena]].

⥅ node [[ed]] pulled by Agora

📓 garden/melanocarpa/ed.myco by @melanocarpa

ed(1) is line-oriented text editor, originally created in the times when people used teletypes to operate computers.

Nowadays, it is mostly useless, yet I am somewhat capable of using it. Here are the use-cases for using it I had:

When the previous text in the shell is needed for me to edit the file and I'm lazy to make an extra effort to have both the text and a visual (visual as in not line-oriented) editor. For example: {

$ ls
i-need-this-filename  this-one-too
$ ed ~/important.txt
a
some important text that i cannot write without remembering the filenames
.

Easy as that. }

In vim or neovim, when I have an opened terminal pane and I want to quickly edit a file in the same window (using vim terms) without removing the terminal from there.

Both use-cases are questionable, yet I used ed(1) in these cases. What're you gonna do?

So, the fact that ed(1) does not overlay the shell is a useful trait. Another useful trait is that it opens files on the last line. It lets you make quick notes along the way, with no need for extra software!

$ doing something very important
this is an important output
$ ed ~/notes.txt
a
Here's a very cool idea I had and that I do not want to forget and I'm scared to switch the window to a note-taking program or a browser.
.

Actually, ed(1) is quite good for adding new text to documents! But actually editing them? Thanks, no.

= What's that (1)? ed(1)'s documentation is available in man. Run man ed to read if, if you have ed(1) installed.

In man, there are 8 standard sections of manuals, numbered from 1 to 8, with 1 corresponding to general commands, which ed(1) seems to be. The man viewer even says ED(1) on top of the document.

I guess that's where that comes from.

Why do I write it like that? Because that's what the person managing [[https://twitter.com/ed1conf]] does and I like it and find it fun and funny. I wonder if they were the first to do so.

= See also

[[Edbrowse]], an ed(1)-inspired editor+browser+mail client.

⥅ node [[edn]] pulled by Agora

📓 garden/flancian/edn.md by @flancian

[[pull]] [[extensible data notation]]
- [[go]] https://github.com/edn-format/edn

⥅ node [[eee]] pulled by Agora

📓 garden/neil/eee.md by @neil

EEE

EEE includes a wide range of products with circuitry or electrical components with a power or battery supply

– [[The Global E-waste Monitor 2020]]

⥅ node [[eeg]] pulled by Agora

📓 garden/karlicoss/misc/eeg.md by @karlicoss

OpenBCI is best apparently?

At Drexel we've had a lot of success with openBCI. I can't comment on all of the other choices, but I think for the money, OpenBCI is a great choice. We've had an advanced undergraduate co-op in our lab working with it for about 2 months, and he's gotten a 16ch board put together and connected to a 3d printed headset we bought, gotten openBCI fully running, connected it to OpenVIBE and begun running their modules. Full access to the data, including in Matlab.
https://github.com/OpenBCI

ganglion? https://shop.openbci.com/collections/frontpage/products/pre-order-ganglion-board?variant=13461804483 can do EEG, EMG, ECG

https://neurobb.com/t/is-there-really-no-affordable-user-friendly-neurofeedback-hardware-software-out-there/75

One option would be to go with OpenBCI hardware and a (relatively) inexpensive proprietary neurofeedback software option like BioEra 290. I have not used BioEra, but it is compatible with OpenBCI and is much more geared towards neurofeedback than BrainBay or OpenViBE. A somewhat more expensive hardware option is Pocket-Neurobics 325, which works with BioEra or BioExplorer, and is apparently popular among home neurofeedback trainers. As @curiositry mentioned, William Croft 104 is a great resource on this topic.

https://www.youtube.com/watch?v=QIWswAOFp8w

needs a special bt dongle?
mark 4 doesnt require any paste, it's dry

https://www.youtube.com/watch?v=agV1B2l-QLw

ok, so it looks pretty easy to filter individual frequencies too.

print it youself: about 500$ =/

could try using 3d printer at work?

http://www.autodidacts.io/getting-started-with-openbci-a-tutorial-on-testing-troubleshooting-and-recording-ekg/

+ The OpenBCI arrives pre-assembled and tested, and is relatively straightforward for someone without previous bci experience to get started with — no soldering, hair-tearing, or midnight coding sessions need appl

+ Finally, the OpenBCI’s output is far closer to clinical or research grade than most consumer or amateur systems: It has an excellent sample-rate (250 Hz), works with well-established processing and display software, and can be used with any electrodes with industry-standard “touchproof” connectors, so you aren’t stuck with the type it comes with.

? use 32 but Which should you choose? In most cases, it probably doesn’t matter. If you’ve used Arduino before, the 8bit would be a good choice. Also, the Arduino community is quite active and helpful. The 32bit version is more powerful, which means that it can do more processing on the signal before it’s sent over bluetooth. If you plan on doing a lot of with tinkering with the code running on the OpenBCI itself, the 32bit version may be a better choice.

? need 10-20 paste?

? TODO how to secure electrodes

- very little data on the internet and reddit.. unlikely to get any help if i buy it

eh. quite costy. so buy it, but ONLY after you consolidate all other sleep trackers so you could compare

Do you have fine control of your head and neck? If so then a headset with a gyro will be much better (Muse by InteraXon or Emotiv).

https://www.reddit.com/r/eeg/comments/6bqd63/looking_for_affordable_wired_personal_eeg/
https://www.reddit.com/r/eeg/comments/3vxbem/comparison_of_consumer_eeg_devices/
http://www.autodidacts.io/neurotech-hardware-roundup-eeg-bci-tdcs-neurofeedback/

ultracortex: 3d printed

`[2018-07-15]` how are EMG and EEG different? [[emg]]

ok, so surface EMG needs two electrodes since it's recording potential difference

EMG? how can it be used [[emg]]

https://youtu.be/gHsZ0bwxMsg?t=3m21s
stronger exercise – stronger signal
https://en.wikipedia.org/wiki/Electromyography#Normal_results

ok, so on reddit everyone claims relation between EMG and muscle activation is unclear

https://www.reddit.com/r/Fitness/comments/ime4r/inside_the_muscles_best_ab_exercises_6/
howerer, I could get some pretty interesting data!

in particular, it's hard to interpret signal correctly

https://www.reddit.com/r/bodybuilding/comments/1vcwc0/emg_activity_results_on_backsquats_vs_front_squats/cer04il/?utm_content=permalink&utm_medium=front&utm_source=reddit&utm_name=bodybuilding
e.g. you should prob be looking for frequency rather than amplitude
Being "strong" means exerting the same amount of force with a lower number of recruited motor units.

https://www.reddit.com/r/bodyweightfitness/comments/7x0jqq/_/

smth about EMG misuse

devices

https://www.amazon.co.uk/ADVANCER-TECHNOLOGIES-Muscle-Sensor-MyoWare/dp/B018TIWR32/ref=sr_1_3?ie=UTF8&qid=1531258073&sr=8-3&keywords=EMG+sensor

43 gbp

https://shop.openbci.com/collections/frontpage/products/myoware-muscle-sensor?variant=29472011267

https://www.amazon.co.uk/MyoWare-Muscle-Sensor-Development-Kit/dp/B01LX6MX4P/ref=sr_1_5?ie=UTF8&qid=1531258073&sr=8-5&keywords=EMG+sensor

kit for 99

aliexpress?

Neurosky?

? 1 channel

+ I did some fairly extensive testing of the Neurosky device while I was working on an app to analyze brainwave signals.

- pretty expensive on amazon :( about 150 GBP?

Neuroonopen

https://neuroonopen.com/

+ alarm LED and vibration

? Only four states are recognized though: awake, light sleep, REM sleep and deep sleep. [reddit]

- I got it, doesn't do anything regarding helping you achieve polyphasic sleep which is the frigging reason of why I supported the kickstarter in the first place. [reddit]

- the hugest minus in my opinion: you can not zoom within your sleep graph. You can see that you fell into deep sleep approximately but you will never know at which hour exactly. This is fairly annoying.

- no news from them

Emotiv https://www.emotiv.com/comparison/

emotiv insight is 200. If not emotiv, you'd be better off making your own for that price.

http://openeeg.sourceforge.net/doc/

- I have not tried emotiv but I was put off by the $500 SDK. You are selling the device and want people to develop for your platform to extend it and you are charging them for the SDK??

- raw data costs a lot

- have to use their software

The Emotiv forces the user to use their software. Raw data costs A LOT extra. Muse + OpenBCI give raw eeg data free. In fact, they give everything except the hardware for free. OpenBCI is completely open source (their name is proprietary....for prosperity). Emotiv sensors are finnicky. They work, they don't work. You can never tell when they will have a good or bad day. Look at the community around their hardware (from my comment above).
OpenBCI gives you the freedom to select your own electrodes (wet, dry, amplified, etc.) You are free to use whichever development platform you are comfortable in (matlab, BCI2000, Python, OpenVibe, Go....)
Muse has a good set of dry sensors. They work. I've even used them in a project at the SF Exploratorium, and at a Tech summit in Shenzhen.

http://www.exploratorium.edu/press-office/press-releases/new-exhibition-understanding-influencing-brain-activity-opens
http://www.cre8summit.io/
OpenBCI and Muse have thriving communities. Here's some of them: http://neurotechx.com/
https://neurobb.com/
http://openbci.com/community/
I am a part of that open community and it really is great to participate with such friendly, open, intelligent people.
permalinkembedsaveparent

Muse band [[buy]] [[qs]] [[meditation]]

After purchasing a Muse headset as part of a project to improve focus & reduce distractibility, I started meditating with the band to determine how it can impact my mental focus.
The Muse headband is a brain wave tracking device that comes with a cell-phone app to measure effectiveness of any meditation session. There are 7 sensors on the headband to get an overall picture of what the brain is doing.

? 4 channels
? 269 GBP
PRO sdk is free
PRO guy from QS meetup (Tony) recommended it, however his app seemed to be a bit clunky..
[2018-01-22]

CON dont bother even with trying it [–][deleted] 39 points 1 year ago*

dont bother even with trying it. while Ive not seen a teardown of this device nearly all of these "mind reading" devices are simply a neurosky thinkgear TGAM module in some packaging and rebranded as some new super tech. these modules are the same ones in those japanese cat ears that read your brain and move the ears, the gaming headsets you are supposed to be able to trigger, and the various "personal mental training devices" like this one.
its a single channel EEG that basically works as an on off switch when various brainwaves hit enough activity. three problems
one or just a few channels is not enough data for any real amount of "sensing" nor is it enough channels of data to even get a basic picture of overall brain activity.
these devices are super slow in response time so they are nearly useless. by the time it senses and you notice its like 2 seconds or so. that makes it only useful for these "meditation" applications since no realtime work or actions can be done with them. (otherwise we would be using decades old EEG tech for lots of cool stuff)
the actual different brainwaves are usually not individually used and instead are combined into a generic "activity level" which again is of little use.
if you really want to mess with them buy any of these devices or any of the "mindflex toys" which contain these modules and read the values directly with a microcontroller.

https://www.reddit.com/r/Biohackers/comments/8imlo7/muse_headband_has_anyone_here_tried_it/
hmm people here generally recommend it…

xxx `[2018-07-15]`

ok, so apparently objections are that often it can't distinguish between muscular activity and brain activity.

what's it composed of

right so it's got 7 sensors

https://medium.com/pixeldreams/my-40-day-journey-into-meditation-with-muse-the-brain-sensing-headband-12e7b060c6fa

interesting, spikes on graphs when he had epiphanies. I guess that could be interesting data to see when I experience cool effects?

yeah. Definitely, these types of plots could keep me motivated. do it.

the guy is quite decent though. doing lots of self experiments, cool.

final decision: ok, the data is useful and I don't care that much about neurofeedback. instead, invest in proper openbci??

good review https://www.warrior.do/muse-headband-review/

If you’re a beginning meditation practitioner, the Muse is great at helping flag when you’re mind is active or calm. The first year of using The Muse, the feedback was amazing to quiet my mind, as I was still learning the basics of the practice.

But as my skills improved, the device wasn’t as useful as before. I’ve found that if you’re an intermediate or an advanced meditator (whose beta/alpha wave fluctuation are much more subtle), the device is relatively crude in picking up these signals.

For example, if I’m now in a session and my mind ever so slightly shifts focus away from my breath, I’ll catch these thoughts but it will go undetected on the Muse. I’m in the process of transitioning to a higher-end device that is more accurate and sensitive to these subtle electrical changes in my brainwaves.

mindflex toys??

https://johnfawkes.com/becoming-superhuman-through-diy-brain-scanning/

bci

https://www.scientificamerican.com/article/pogue-6-electronic-devices-you-can-control-with-your-thoughts/
https://www.reddit.com/r/DrugNerds/comments/2pmnxc/im_using_an_eeg_neurofeedback_machine_to_measure/

`[2019-02-04]` neurable: Announcing the world’s first brain-computer interface for virtual reality [[eeg]] [[vr]]

https://medium.com/neurable/announcing-the-worlds-first-brain-computer-interface-for-virtual-reality-a3110db62607

`[2019-02-15]` dunno, almost nothing on reddit, you can't buy it now etc. try again somewhat later…

`[2019-01-24]` EEG-SMT - Open Source Hardware Board [[eeg]]

https://www.olimex.com/Products/EEG/OpenEEG/EEG-SMT/
ok, people on reddit generally recommend it…

`[2019-01-27]` How to build a brain interface — and why we should connect our minds [[eeg]]

https://medium.com/@justlv/how-to-build-a-brain-interface-and-why-we-should-connect-our-minds-35003841c4b7
describing various potential neurointerfaces – somewhat interesting stuff

`[2019-02-24]` Somaxis EMG EKG EEG sensors – muscle, heart, brain, posture, activity

http://www.somaxis.com/
huh that's interesting

Some EEG stuff

`[2019-01-20]` BioShare.info

https://www.bioshare.info/en

`[2019-01-20]` Physiological Monitoring | HaB Direct

https://www.habdirect.co.uk/product-category/fitness/fitness-testing-and-sports-performance/activity-monitoring-fitness-testing-and-sports-performance/

`[2019-01-20]` BioHarness 3 Compression Shirts | HaB Direct

https://www.habdirect.co.uk/product/bioharness-3-compression-shirts/?attribute_size=Medium&gclid=CjwKCAiAsoviBRAoEiwATm8OYIZqIO56Lq78SqDfgoV5j6QuQq9eh5qlh3Y_7fMDN_2kWD66lexhlxoCGykQAvD_BwE

`[2019-01-20]` SnapECG Portable EKG Monitor, Handheld ECG Heart Rate Monitor for Smart Phone, Wireless Heart Performance Tracking without ECG Electrodes Required, Home Use Ekg Monitoring Devices for iPhone & Android: Amazon.co.uk: Sports & Outdoors

https://www.amazon.co.uk/SnapECG-Portable-Performance-Electrodes-Monitoring/dp/B07FKYPTDQ/ref=sr_1_3?ie=UTF8&qid=1547946837&sr=8-3&keywords=qardiocore

`[2019-01-20]` EKG ECG Heart Rate Monitor: QardioCore Continuous Electrocardiograph ECG/EKG Mobile Machine - Wireless, Portable, Wearable Heart Monitoring Equipment - Bluetooth Mobile Digital Cardio Devices: Amazon.co.uk: Health & Personal Care

https://www.amazon.co.uk/EKG-Heart-Rate-Monitor-Electrocardiograph/dp/B073VW2ZZV/ref=sr_1_1_a_it?ie=UTF8&qid=1547946837&sr=8-1&keywords=qardiocore

`[2019-01-20]` eMotion EMG | shop.bittium.com [[emg]] [[qs]]

https://shop.bittium.com/product/6/emotion-emg
fucking hell… 4K!

`[2019-01-20]` Bittium Faros - Bittium [[hr]]

https://www.bittium.com/products__services/medical/bittium_faros#technical_details
looks very cool, but also fucking expensive, 3K

`[2019-01-20]` My Baseline Network Physiology: 10 Days of EEG, EGG, EKG, CGM, Temperature, Activity and Food Logs - Quantified Self / Project Logs - Quantified Self Forum [[qs]]

https://forum.quantifiedself.com/t/my-baseline-network-physiology-10-days-of-eeg-egg-ekg-cgm-temperature-activity-and-food-logs/5671/21
awesome correlation experiment between hr, body temperature, food etc

`[2019-01-20]` DS1922L-F5# Thermochron iButton [-40 to 85°C] - 8K Memory | iButtonLink [[qs]]

https://www.ibuttonlink.com/products/ds1922l
think for body temperature tracking… although would be very adhoc, would need a patch to hold it or something like that. expect the skin to be irritated

`[2019-01-20]` MySignals - eHealth and Medical IoT Development Platform [[qs]] [[gadget]]

http://www.my-signals.com/
that costs about 1K, but looks pretty cool. EKG, EMG, respiratory sensor etc. will be inconvenient to wear though

`[2019-01-20]` Reliable wearable ECG - Quantified Self / Apps & Tools - Quantified Self Forum [[hr]]

https://forum.quantifiedself.com/t/reliable-wearable-ecg/2653
a lot of ecg related medical grade tools

`[2019-01-20]` Firstbeat Firstbeat Bodyguard 2 [[hr]]

http://shop.firstbeat.com/us/bodyguard.html#.XEQ3KVX7TMg
uses electrodes..
ok, so apparently currently there is no reliable way of tracking very accurate continuous HR without changing electrodes etc

`[2019-05-10]` New neural implant in trials /r/BrainMachineInterface [[bci]]

`[2019-05-12]` huh, pretty cool, electrod mesh injected via a vein right into the brain

EEG/EMG

`[2019-01-20]` Backyard Brains Store https://backyardbrains.com/products/ [[hobby]]

`[2019-01-25]` hmm that looks pretty promising I think

`[2019-02-24]` huh? free delivery? https://www.onbuy.com/gb/science-and-discovery/backyard-brains-muscle-spikerbox-neuroscience-in-a-box~c2371~p6511442/

`[2019-01-20]` Myoware EMG Sensor - Arduino Tutorial | Cost Effective EMG Sensor - RootSaid [[emg]]

https://rootsaid.com/myoware-emg-sensor-arduino/

`[2019-01-25]` simple tutorial.. but fuck it's so tedious to read the signal! E.g. you need to clean the skin etc.

`[2019-02-24]` https://www.youtube.com/embed/DOFtN67y1j0 hmm, that looks promising..

`[2019-01-25]` Advancer Technologies, LLC: [DIY] Conductive Fabric Electrodes [[emg]]

http://www.advancertechnologies.com/2013/03/diy-conductive-fabric-electrodes.html
hmm, that's pretty cool, could get reusable electrodes that way

`[2019-02-14]` Hacking Your Brain Waves: A Guide To Wearable Meditation Headsets https://www.diygenius.com/hacking-your-brain-waves/

`[2019-02-24]` TrueSense Exploration Kit | OP Innovations [[eeg]] [[emg]]

https://www.op-innovations.com/en/node/96

`[2019-04-11]` Anyone had experience with EEG headsets? : QuantifiedSelf https://www.reddit.com/r/QuantifiedSelf/comments/ac5x6u/anyone_had_experience_with_eeg_headsets/

I wrote an app for the NeuroSky, but eventually gave up on it because getting a good signal was so tedious.

`[2019-05-21]` How to Hack Toy EEGs | Frontier Nerds http://www.frontiernerds.com/brain-hack

`[2019-05-21]` Home [[eeg]] [[vr]]

https://myndplay.com/

`[2019-06-22]` Contents — visbrain 0.4.4 documentation [[emg]] [[viz]]

http://visbrain.org/index.html

Visbrain documentation _static/ico/visbrain.png
A multi-purpose GPU-accelerated open-source suite for brain data visualization.

`[2019-04-15]` Using deep learning to “read your thoughts” — with Keras and an EEG sensor [[eeg]] [[mind]] [[openbci]]

https://medium.com/@justlv/using-ai-to-read-your-thoughts-with-keras-and-an-eeg-sensor-167ace32e84a

`[2019-07-31]` very cool! lots of good techniquies with signal processing and neural networks

`[2019-07-20]` Inria - Comparison of a consumer grade EEG amplifier with medical grade equipment in BCI applications https://hal.inria.fr/hal-01278245

Abstract : This paper presents a comparison between a consumer grade EEG (electroencephalography) amplifier and a medical grade equipment. Using the same set of EEG electrodes, signals recorded from the OpenBCI board are compared side-by-side with those recorded from the g.tec g.USBamp device. Two BCI (brain-computer interface) applications are studied: a P300 speller and a workload estimator. In both applications EEG features are highly correlated. Moreover, the classification performances obtained with the OpenBCI board come close to the accuracy achieved with the g.tec g.USBamp. Overall, these preliminary results suggest that the OpenBCI board -- or a similar solution based on the Texas Instrument ADS1299 chip -- may be an alternative to traditional EEG amplifiers, widening the realm of applications and increasing the number of potential users.

`[2019-07-20]` MIT researcher takes the quantified self to the extreme with an EEG helmet — Quartz https://qz.com/1348242/the-human-cyborg-collecting-his-memories-on-video/

`[2019-02-24]` Alex Grey on Tracking Muscle Data (EMG, ECG) - Quantified Self [[qs]] [[emg]]

http://quantifiedself.com/2012/03/alex-grey-on-tracking-muscle-data-emg-ecg/

`[2019-02-24]` QS Resource Guide [[emg]]

http://experimentable.com/qs-guide/

`[2018-07-14]` ici·bici: here's a low cost, open source brain-computer interface [[bci]] [[eeg]]

https://icibici.github.io/site/
https://www.reddit.com/r/NeuroHacking/comments/89qasr/does_anybody_knows_how_to_buy_this_bci_20_kit/ mm unclear how to buy it…

Melon band: dismissed? https://www.reddit.com/r/QuantifiedSelf/comments/6qke2e/what_to_do_with_this_melon_eeg_headband_now_that/

related [[emg]] [[bci]] [[qs]]

`[2019-09-02]` Mind controlled text writer /r/Python [[eeg]] [[openbci]]

https://www.youtube.com/watch?v=1GdjMx5t4ls

**Idea of P300 speller:**
Highlight rows and cols and record EEG reaction to these events. If row/col with target character is highlighted \~after 300ms peak on EEG diagram will occur and it's possible to train classifier to  detect it. To remove noise from EEG data repeat it multiple times and use bandpass filter

**Hardware:** [OpenBCI Cyton](https://brainflow.readthedocs.io/en/latest/SupportedBoards.html#openbci-cyton)
**Software:**
* [BrainFlow library](https://github.com/Andrey1994/brainflow) to read and preprocess data from OpenBCI board
* [P300 implementation](https://github.com/Andrey1994/brainapps/tree/master/p300-speller)

⥅ node [[efd]] pulled by Agora

📓 garden/flancian/efd.md by @flancian

#pull [[executive function disorder]] [[add]] [[adhd]]
#pull [[icnu]]
- #pull [[I will do what I want]]

⥅ node [[eff]] pulled by Agora

📓 garden/flancian/eff.md by @flancian

EFF

a [[project]]
- I am a [[fan]].
- [[pull]] [[electronic frontier foundation]]
- [[go]] https://eff.org

⥅ node [[ein]] pulled by Agora

📓 garden/vera-wiki-anagora-org/ein.md by @vera-wiki-anagora-org

A tax number. Essentially a social security number for a coporation

⥅ node [[eli]] pulled by Agora

📓 garden/flancian/eli.md by @flancian

a [[person]].
- #go https://eli.li/about
- #pull [[eli oat]] [[oat]]
- started [[december adventure]]

⥅ node [[elk]] pulled by Agora

📓 garden/flancian/elk.md by @flancian

[[Fediverse]]:
- a [[client]].
  - #go https://elk.zone

⥅ node [[erc]] pulled by Agora

📓 garden/neil/erc.md by @neil

ERC

This is an [[IRC]] client in [[Emacs]]. I'm using [[ZNC]] as an IRC bouncer, so some of this might only apply if you're using ZNC too.

Hiding alerts

(setq erc-hide-list '("JOIN" "PART" "QUIT"))

– https://emacs.stackexchange.com/questions/26997/erc-mode-how-to-hide-alerts-when-users-join-leave-a-channel

Setting default server

In spacemacs, they are set at the point of including the erc layer in your layers config.

(erc :variables
	erc-server-list
	'(("irc.example.com"
		:port "6770"
		:ssl t
		:nick "nick"
		:password "password")))

IMPORTANT NOTE: don't actually put your password in the config - https://www.spacemacs.org/layers/+chat/erc/README.html#security-note

machine <irc.server.url> login <yournick> password <yourpassword> port <portnumber>

⥅ node [[erp]] pulled by Agora

📓 garden/neil/erp.md by @neil

ERP

⥅ node [[ert]] pulled by Agora

📓 garden/neil/ert.md by @neil

ERT

Library for running tests against [[elisp]] code.

Bookmarks

https://www.gnu.org/software/emacs/manual/html_node/ert/index.html

⥅ node [[es]] pulled by Agora

📓 garden/flancian/es.md by @flancian

Es

[[push]] [[español]] [[spanish]]
- Escribo en el ágora mayormente en inglés porque es un gran idioma de difusión internacional, pero es mi intención ser máximamente inclusivo. En mis sueños, el ágora está escrita en todo lenguaje; o en un [[lenguaje universal]].

⥅ node [[esr]] pulled by Agora

📓 garden/flancian/esr.md by @flancian

esr

[[pull]] [[eric raymond]]

⥅ node [[ewp]] pulled by Agora

📓 garden/flancian/ewp.md by @flancian

Ewp

⥅ node [[ex]] pulled by Agora

📓 garden/flancian/ex.md by @flancian

a [[person]].
- [[friend]].
- they helped me during my breakup and I'm grateful.

⥅ node [[ext]] pulled by Agora

📓 garden/karlicoss/projects/ext/ext.md by @karlicoss

[* Logseq](#logseq TIDDLYLINK) [[logseq]]
- [[search could be wider and include more stuff?]] [[exobrain]]
- [[suggestions]]
  - [2020-12-30] display 'current' graph without clicking on 'page graph' all over again? [[outbox]]
  - [2020-12-30] hmmm… I'd like to see 'related' pages, e.g. when certain tags are siblings?
  - [2020-12-30] eh. singe page (toexobrain export) didn't quite work well
- [[might be nice to have several 'layers']] [[exobrain]]
- [2020-12-29] Publishing [[logseq]] [[exobrain]]
- [[dev mode suggesion: reindex on refreshed code (or force reindex)]] [[outbox]]
- [[node size proportional to the number of links?]] [[exobrain]] [[logseq]]
- [[hmm, if title is missing, might be better to use filename (now it's picking the first heading)]] [[exobrain]]
- [[if it used custom ids would be awesome..]]
- [[need a mode to exclude headings from notes graph? although not sure]] [[exobrain]]
- [[colour differently pages with the corresponding file and without (i.e. tags)]] [[logseq]] [[exobrain]]
- [2021-01-07] logseq/graph.cljs at 14e4af295781a00aacdb9104bda9c8121000b2cb · logseq/logseq [[logseq]]
- [[auto push could push on a separate branch? and the actual normal push could be manual?]] [[logseq]]
- [2021-01-08] right, it treats # as tags? [[org]]
- [[need to highlight connections when I drag the enode]] [[logseq]] [[exobrain]]
- [[ignore tags: read watch inspiration motivation buy outbox ? maybe even study? they result in too many connections]]
- [2021-01-18] logseq/config.cljs at master · logseq/logseq
- [2020-12-30] Directory handle not exists (local filesystem) · Issue #918 · logseq/logseq
- [[do not parse tags in quoted text]] [[logseq]]
- [2020-12-30] using heading as title [[logseq]]
- [[wtf??]] [[logseq]]
- [[ask for publishing from console]] [[logseq]]
[* Orgzly](#rgzly TIDDLYLINK) [[orgzly]]
- [debugging SQLiteDatabase: /data/user/0/com.orgzly/databases/orgzly_test.db](#dbggngsqltdtbsdtsrcmrgzlydtbssrgzlytstdb TIDDLYLINK)
- [[feat: interface for fs browsing]]
- [[feat: open org files in orgzly]] [[org]]
  - [[Wonder if i could implement simple org viewer with org-java?]] [[org]] [[android]]
- [[https://github.com/orgzly/orgzly-android/issues/345]] [[spacedrep]]
- [[feat: capture templates? With screen buttons]]
- [[Orgzly notification high priority only? Or even a search query]]
  - [[you know if anyone started progress on that? If not I might give it a try.]]
- [[bug: cut note and then create new in an empty notebook – the note you cut disappears]]
- [[Orgzly quick search widget?]]
- [[todo state changes]]
  - [[make sure orglzy can handle that??]]
- [[Orgzly archive]]
  - [2019-02-10] there were some suggestions already, for tagging in particular https://github.com/orgzly/orgzly-android/issues/32
- [2019-02-10] Implement auto synchronization · Issue · orgzly/orgzly-android [[orgzly]]
- [[Post about orgzly on fossdroid?]]
- [2019-12-15] Detect org files in subfolders · Issue #225 · orgzly/orgzly-android
  - [2019-12-15] Detect org files in subfolders · Issue #225 · orgzly/orgzly-android
- [2020-07-11] [orgzly/orgzly-android] Detect org files in subfolders
[* syncthing](#syncthng TIDDLYLINK) [[syncthing]]
- [[suggest heartbeats for syncthing?]] [[cloud]]
- [2019-09-06] dschrempf/syncthing-resolve-conflicts: A small bash script that handles synchronization conflicts with Syncthing. Inspired by 'pacdiff' from Arch Linux. https://github.com/dschrempf/syncthing-resolve-conflicts
- [2019-09-06] jjkramok/syncthing-conflict-notifier: Detects conflict files in a single syncthing shared folder and sends a push notification if conflicts are found. https://github.com/jjkramok/syncthing-conflict-notifier
- [2020-04-12] issue with Out of sync items/ sync stuck at 99%
- [[commit conflict detector? show alter in the inteface]]
  - [2020-12-19] eh? apparently it's already presetn? https://github.com/kozec/syncthing-gtk/issues/261
- [[ok, syncthing paranoid should simply reuse logic in cloud-heartbeat]] [[cloud]]
- [[had a bug: in pkm dir]] [[cloud]]
- [[Better indicator for syncthing? In mc and in gui?]]
- [[run git gc occasionally? can remove quite a lot of objects…]] [[cloud]]
  - [2020-06-07] yeah, it's a really good idea.. wonder how to run it more often
- [2019-04-17] implement more regular checks for syncthing?
  - [2019-04-17] also allow selective syncing on mobile/wifi
- [2019-06-05] shit, weird. syncthing has got some sort of mismatch between GUI and web file/folder count; borg was showing differnt counts as well (script in dropbox that I used to check for differences) [[cloud]]
[* wildcard](#wldcrd TIDDLYLINK) [[wildcard]]
- [2020-05-13] Ask HN: Anyone else upvote HN comments to track comments they have already read? | Hacker News [[pkm]]
- [2020-05-05] SelectorGadget: point and click CSS selectors [[css]]
- [2020-05-11] (10) jestem króliczkiem on Twitter: "@jtraub аа, понял. Крутая идея, да! это было бы оч легко, даже не модифицируя экстеншн если бы браузеры разрешали экстеншнам друг на друге оперировать, а так можно будет добавить в Wildcard" / Twitter
- [[ok, what if we combine them?]] [[promnesia]] [[worldbrain]] [[wildcard]]
- [[firefox logging]]
- [[wip on DSL issue]]
- [2020-05-07] Restrict expressiveness of site adapters · Issue #17 · geoffreylitt/wildcard
- [[Generic scraping with chrome inspector?]]
- [['exploring queue', mark explored elements and never show them again]] [[jonbo]] [[wildcard]]
- [2020-05-11] bug: Vrroom
- [2020-05-12] Fraidycat
- [2020-05-16] Generate RSS feeds for any web page | PolitePol
- [[would be nice to keep images outside of the git repository… perhaps even prune]]
- [2020-05-26] (2) Jared Palmer on Twitter: "PSA: You can usually crank up Webpack rebuild/HMR speed by ~7x on TypeScript projects by doing this to your Webpack config in development. Diff to create-react-app: https://t.co/nMikcH4At8 https://t.co/TgPl5LUwLH" / Twitter [[wildcard]]
[* sympy](#sympy TIDDLYLINK) [[sympy]]
- [[Add.matches???]] [[sympy]]
- [[use wild to deconstruct expressions?]] [[sympy]]
- [[started solving that system of DEs]] [[sympy]]
- [[try dsolveset??]] [[sympy]]
- [2018-12-24] Added a few rules for imageset simplification by hargup · Pull Request 7625 · sympy/sympy
- [[dsolve bug https://github.com/sympy/sympy/issues/15707]] [[sympy]]
- [[add wave eq to sympy??]] [[sympy]]
[* materialistic app for #hackernews](#mtrlstcppfrhckrnws TIDDLYLINK)
- [2019-12-21] [#C] set link as a title when sharing?? https://github.com/hidroh/materialistic/issues/1075
- [[Hn materialistic: change view on press]]
- [[Hn Materialistic: comment icon is way too large for the number of comments]]
[* git-bug](#gtbg TIDDLYLINK) [[gitbug]]
- [2020-11-02] git-bug isn't syncing PRs?
- [2020-11-21] git-bug/import.go at b3318335986618388637a9d35d68b39633e4548a · MichaelMure/git-bug
[* Hypothesis](#hypthss TIDDLYLINK) [[hypothesis]]
- [[need to color my and other people highlights in diff colors]]
- [2018-06-11] just be a bit more explicit about not logged in
- [2019-02-20] hypothesis/client: The Hypothesis web-based annotation client.
- [[doesn't work on hackernews, some content-security policy thing]] [[hypothesis]]
- [2020-05-05] history.txt [[hypothesis]] [[annotation]]
- [2019-07-18] John Maynard Keynes: "Newton, the Man"
- [[bug: ugh, doesn't work with Linkedin]]
- [[ugh, seems that pseudoelements like in ampie and promnesia mess with hypothesis highlight]] [[hypothesis]]
- [2021-03-06] Shirky: Situated Software [[hypothesis]]
[* tantivy](#tntvy TIDDLYLINK) [[tantivy]]
- [[Try search as you type on Wikipedia]] [[tantivy]]
- [[host wikipedia backend for a bit and give a frontend link to github issue]] [[tantivy]]
- [[tantivy-py: need to bump version to -dev or something?]] [[tantivy]]
[* twint](#twnt TIDDLYLINK) [[twint]]
- [[not sure about –profile-full??]] [[twint]]
- [[hmm. it looks like it can't parse tweet ids??]] [[twint]]
- [2020-04-13] Show HN: Twint – Twitter scraping tool written in Python | Hacker News [[twint]] [[promnesia]] [[hpi]]
  - [2020-04-14] Home · twintproject/twint Wiki [[hpi]]
[* org-sync](#rgsync TIDDLYLINK)
- [2019-12-27] not sure if I like sorting by modified time… OPEN and id is better [[orgsync]]
- [2020-04-12] for org-sync thing – could keep private notes in a separate file, but link into ids? [[github]]
[[--]]
[[share link and content]] [[tusky]]
- [2020-01-25] https://github.com/tuskyapp/Tusky/issues/1655
[[validate systemd?]] [[pyinfra]]
[[ncmpcpp file name too long]] [[mpd]]
[update miniflux docs, mention that CLEANUP_ARCHIVE_READ_DAYS docs](#pdtmnflxdcsmntnthtclnprchvrddysdcs TIDDLYLINK)
[[PR in toastify for innerHTML]]
[2019-09-08] Validate inputs before saving · Issue #2 · fregante/webext-options-sync
[[problem with escaping table name]] [[visidata]]
[[Allow users to mark posts as searchable/not searchable?]] [[mastodon]]
[2020-12-11] Export annotations - ⭐️Feature Requests - Memex Community [[worldbrain]]

* Logseq [[logseq]]

Logseq is a #localfirst browser interface for #org (mode). I'm using it for my #exobrain

search could be wider and include more stuff? [[exobrain]]

suggestions

`[2020-12-30]` display 'current' graph without clicking on 'page graph' all over again? [[outbox]]

`[2020-12-30]` hmmm… I'd like to see 'related' pages, e.g. when certain tags are siblings?

https://discord.com/channels/725182569297215569/725182570131751005/746244953910411324
maybe https://github.com/logseq/logseq/issues/207

`[2020-12-30]` eh. singe page (toexobrain export) didn't quite work well

relativize links in index.html? then easier to use as a single page app without selfhosting
graph doesn't seem to work
[2020-12-30] ok, try switching abs paths to relative

might be nice to have several 'layers' [[exobrain]]

e.g. people could be on a different layer
it could be achieved by having them not participate in constraints and just layed out on top with different color?

`[2020-12-29]` Publishing [[logseq]] [[exobrain]]

ok, nice, this worked (need to run http server though, doesn't work as a fully static page?)

dev mode suggesion: reindex on refreshed code (or force reindex) [[outbox]]

node size proportional to the number of links? [[exobrain]] [[logseq]]

hmm, if title is missing, might be better to use filename (now it's picking the first heading) [[exobrain]]

if it used custom ids would be awesome..

need a mode to exclude headings from notes graph? although not sure [[exobrain]]

e.g. I want two tags to be connected if they are siblings – basically only want connections between tags? I guess it's kinda subjective

colour differently pages with the corresponding file and without (i.e. tags) [[logseq]] [[exobrain]]

`[2021-01-07]` logseq/graph.cljs at 14e4af295781a00aacdb9104bda9c8121000b2cb · logseq/logseq [[logseq]]

(map (fn [[p aliases]]

aliases for graph view

auto push could push on a separate branch? and the actual normal push could be manual? [[logseq]]

`[2021-01-08]` right, it treats # as tags? [[org]]

need to highlight connections when I drag the enode [[logseq]] [[exobrain]]

ignore tags: read watch inspiration motivation buy outbox ? maybe even study? they result in too many connections

maybe they are more like attributes.. or tiny dots around tag, each of dots represents a task. dunno

`[2021-01-18]` logseq/config.cljs at master · logseq/logseq

`[2020-12-30]` Directory handle not exists (local filesystem) · Issue #918 · logseq/logseq

do not parse tags in quoted text [[logseq]]

`[2020-12-30]` using heading as title [[logseq]]

Yeah, there're some users who rely on the first heading as the page title.
If you prefer to use the file name as the page title instead of the first heading's title, (TITLE -> filename -> first heading), add :page-name-order "file" to the file logseq/config.edn.

wtf?? [[logseq]]

only seems to happen in publishing mode?

Lookup ref should contain 2 elements: ({:page/name "pkm"})

ask for publishing from console [[logseq]]

would also help for testing.. in a way?

* Orgzly [[orgzly]]

Awesome android app for #orgmode
https://github.com/orgzly/orgzly-android

so, every notebok has a root node
unspecified: inserts at the end of root?

note level; level 0 is root

debugging `SQLiteDatabase: /data/user/0/com.orgzly/databases/orgzly_test.db`

feat: interface for fs browsing

The main issue is multiple repositories
Imagine we have
repo1:
dir
file1.org
repo2:
dir
file2.org
we'll have to somehow merge them. Quite annoying!

feat: open org files in orgzly [[org]]

karlicoss/orgzly branch view-org-files

right, so apparently, notes are getting rebuilt every time from database
we could have a temporary database which gets flushed occasionally and never gets displayed?
https://github.com/orgzly/orgzly-android/issues/148

Wonder if i could implement simple org viewer with org-java? [[org]] [[android]]

[2018-11-20] eh, tbh I don't need it that often. I usually use docsearch (or could use recoll!)

https://github.com/orgzly/orgzly-android/issues/345 [[spacedrep]]

feat: capture templates? With screen buttons

State "STRT" from "TODO" [2019-02-21]

https://github.com/orgzly/orgzly-android/issues/80

`[2019-02-21]` shit. gradle sync didn't work. tried updating Kotlin but that didn't help…

`[2019-02-21]` basic idea: first approximation – reuse widget for notebook, just trigger note creation on opening

we want
name, template, target (could be file in the first approximation, but think how we would address subheadings)

how would that work with sync?
how do we handle staling targets?

`[2019-02-24]` https://github.com/orgzly/orgzly-android/pull/466

Orgzly notification high priority only? Or even a search query

https://github.com/orgzly/orgzly-android/issues/245

you know if anyone started progress on that? If not I might give it a try.

I'm not aware of any. That would be great, thanks.
I guess it would be a new preference in Settings / Reminders that can contain a search query?

bug: cut note and then create new in an empty notebook – the note you cut disappears

Orgzly quick search widget?

todo state changes

make sure orglzy can handle that??

State "WAIT" from "TODO" [2019-02-16]
whatever

Orgzly archive

Would require support in notebook interface

`[2019-02-10]` there were some suggestions already, for tagging in particular https://github.com/orgzly/orgzly-android/issues/32

`[2019-02-10]` Implement auto synchronization · Issue · orgzly/orgzly-android [[orgzly]]

https://github.com/orgzly/orgzly-android/issues/8

Post about orgzly on fossdroid?

`[2019-12-15]` Detect org files in subfolders · Issue #225 · orgzly/orgzly-android

https://github.com/orgzly/orgzly-android/issues/225

ctory tree with bunch of org files around it, and right now orgzly only detects the org files on top level. Would

`[2019-12-15]` Detect org files in subfolders · Issue #225 · orgzly/orgzly-android

https://github.com/orgzly/orgzly-android/issues/225

Just checked out attern is having a directorytop level.

`[2020-07-11]` [orgzly/orgzly-android] Detect org files in subfolders

I switched from orgzly to markor exactly because of the lack of this feature. Yes, I know, these apps differs a lot, but I use them simply as a text editor. I'm still waiting when this will become available in orgzly. Why it's so hard to implement it?

* syncthing [[syncthing]]

https://syncthing.net

suggest heartbeats for syncthing? [[cloud]]

`[2019-09-06]` dschrempf/syncthing-resolve-conflicts: A small bash script that handles synchronization conflicts with Syncthing. Inspired by 'pacdiff' from Arch Linux. https://github.com/dschrempf/syncthing-resolve-conflicts

`[2019-09-06]` jjkramok/syncthing-conflict-notifier: Detects conflict files in a single syncthing shared folder and sends a push notification if conflicts are found. https://github.com/jjkramok/syncthing-conflict-notifier

`[2020-04-12]` issue with Out of sync items/ sync stuck at 99%

not sure what exactly caused it, but basically was constantly showing local/global state mismatch
Rest api is on GUI port, key is in advanced settings
https://docs.syncthing.net/dev/rest.html
use the post request to reset the index (apparently no way from GUI)
https://docs.syncthing.net/rest/system-reset-post.html

[2021-05-02] happened again, reset just one folder, was fine after that
maybe relevant to https://forum.syncthing.net/t/deleted-out-of-sync-items-syncthing-stuck/14971/30

commit conflict detector? show alter in the inteface

`[2020-12-19]` eh? apparently it's already presetn? https://github.com/kozec/syncthing-gtk/issues/261

interesting..

ok, syncthing paranoid should simply reuse logic in cloud-heartbeat [[cloud]]

also probably belongs to the same repository altogether

had a bug: in pkm dir [[cloud]]

TODO would be interesting to do fuzzing

before pkm (real dir) pkm/search (symlink) pkm/swoop (symlink)

UNSYNCED!

after pkm: symlink with the same files inside

sync was just stuck

Better indicator for syncthing? In mc and in gui?

Gui – available, mc – not sure how..
mm, doesn't look like there is a nice terminal interface?

run git gc occasionally? can remove quite a lot of objects… [[cloud]]

`[2020-06-07]` yeah, it's a really good idea.. wonder how to run it more often

`[2019-04-17]` implement more regular checks for syncthing?

`[2019-04-17]` also allow selective syncing on mobile/wifi

`[2019-06-05]` shit, weird. syncthing has got some sort of mismatch between GUI and web file/folder count; borg was showing differnt counts as well (script in dropbox that I used to check for differences) [[cloud]]

* wildcard [[wildcard]]

https://github.com/geoffreylitt/wildcard
related: #interop #malleable #spreadsheet

`[2020-05-13]` Ask HN: Anyone else upvote HN comments to track comments they have already read? | Hacker News [[pkm]]

`[2020-05-05]` SelectorGadget: point and click CSS selectors [[css]]

`[2020-05-11]` (10) jestem króliczkiem on Twitter: "@jtraub аа, понял. Крутая идея, да! это было бы оч легко, даже не модифицируя экстеншн если бы браузеры разрешали экстеншнам друг на друге оперировать, а так можно будет добавить в Wildcard" / Twitter

аа, понял. Крутая идея, да!
это было бы оч легко, даже не модифицируя экстеншн если бы браузеры разрешали экстеншнам друг на друге оперировать, а так можно будет добавить в Wildcard

ok, what if we combine them? [[promnesia]] [[worldbrain]] [[wildcard]]

e.g. intercept AJAX request and store them in the database on your disk. Then, add some code to filter it and keep as the browser history?

firefox logging

Another thing I noticed was this bit logging errors all the time for adapters that don't have `scrapeAjax` (I'm on Firefox). I wonder if it's better to check for the att

wip on DSL issue

> Usually I prefer DSLs embedded in a Turing-complete language to provide the TC escape hatch if needed, but here that's precisely what we don't want.

TODO why no escape hatch

I'm (as a somewhat experienced programmer) biased towards having a real programming language, because, because I've struggled with mediocre yaml/json DSL that end up reimplementeing half of the programming language in an incomrehensible ways. E.g. if you already know javascript, you end up frustrated with expressing in DSL what you'd otherwise have don in few lines of code. And the opposite: if you don't know how to program in the first place I'd be much rather

debugging somethine like

>  "xpath": "//*[@class='blog-item']/div[0]"

is kind of a nightmare for anyone, and you need the devtools and JS console for that

TODO something about ids

>  "querySelector": "._i24ijs"

Often (citation needed though) websites have completely dynamic ids, so you would need to do some sort of completely dynamic query to determine the content and the items

`[2020-05-07]` Restrict expressiveness of site adapters · Issue #17 · geoffreylitt/wildcard

contribute to the discussion here

Generic scraping with chrome inspector?

'exploring queue', mark explored elements and never show them again [[jonbo]] [[wildcard]]

`[2020-05-11]` bug: Vrroom

load this page, then click 'repositories', wildcard doesn't show up (it should)
then refresh (shows up, as expected)
then go back – it doesn't disappear (it should)

`[2020-05-12]` Fraidycat

`[2020-05-16]` Generate RSS feeds for any web page | PolitePol

ok, nice so it allows you to choose elements dynamically, could be useful

would be nice to keep images outside of the git repository… perhaps even prune

separate repository for binary assets is better

`[2020-05-26]` (2) Jared Palmer on Twitter: "PSA: You can usually crank up Webpack rebuild/HMR speed by ~7x on TypeScript projects by doing this to your Webpack config in development. Diff to create-react-app: https://t.co/nMikcH4At8 https://t.co/TgPl5LUwLH" / Twitter [[wildcard]]

PSA: You can usually crank up Webpack rebuild/HMR speed by ~7x on TypeScript projects by doing this to your Webpack config in development.

* sympy [[sympy]]

related #sim #math

Add.matches??? [[sympy]]

use wild to deconstruct expressions? [[sympy]]

started solving that system of DEs [[sympy]]

try dsolveset?? [[sympy]]

`[2018-12-24]` Added a few rules for imageset simplification by hargup · Pull Request 7625 · sympy/sympy

https://github.com/sympy/sympy/pull/7625/files

dsolve bug https://github.com/sympy/sympy/issues/15707 [[sympy]]

add wave eq to sympy?? [[sympy]]

1st order linear homogeneous partial differential equations
with constant coefficients.
1st order linear general partial differential equations
with constant coefficients.
1st order linear partial differential equations with
variable coefficients.

* materialistic app for #hackernews

`[2019-12-21]` [#C] set link as a title when sharing?? https://github.com/hidroh/materialistic/issues/1075

Hn materialistic: change view on press

Hn Materialistic: comment icon is way too large for the number of comments

* git-bug [[gitbug]]

related #git #github #decentralize

`[2020-11-02]` git-bug isn't syncing PRs?

`[2020-11-21]` git-bug/import.go at b3318335986618388637a9d35d68b39633e4548a · MichaelMure/git-bug

ugh fuck, this should go to stderr?

* Hypothesis [[hypothesis]]

need to color my and other people highlights in diff colors

`[2018-06-11]` just be a bit more explicit about not logged in

ok, what I actually want is the extension to be more vocal about logouts

https://github.com/hypothesis/client/issues/12

`[2019-02-20]` https://github.com/hypothesis/client/pull/967

`[2019-06-27]` ok, it was partially resolved, at least it expands the sidebar now. Swill major problem for usability though, can easily disapppoint new users.

`[2019-02-20]` hypothesis/client: The Hypothesis web-based annotation client.

Join us on Slack - request an invite or log in once you've already created an account - or in #hypothes.is on freenode for discussion.
If you'd like to contribute to the project, you should consider subscribing to the development mailing list, where we can help you plan your contributions.

doesn't work on hackernews, some content-security policy thing [[hypothesis]]

`[2020-05-05]` history.txt [[hypothesis]] [[annotation]]

doesn't work on github?? ugh.

`[2019-07-18]` John Maynard Keynes: "Newton, the Man"

about:reader?url=http%3A%2F%2Fwww-history.mcs.st-and.ac.uk%2FExtras%2FKeynes_Newton.html
hmm, hypothesis doesn't work with Firefox reading mode?

bug: ugh, doesn't work with Linkedin

ugh, seems that pseudoelements like in ampie and promnesia mess with hypothesis highlight [[hypothesis]]

e.g. try to highlight over "eg with blue-blocker sunglasses or f.lux) after sunset" on this page
https://www.lesswrong.com/posts/E4cKD9iTWHaE7f3AJ/melatonin-much-more-than-you-wanted-to-know#5__I_try_to_use_melatonin_for_sleep__but_it_just_gives_me_weird_dreams_and_makes_me_wake_up_very_early

`[2021-03-06]` Shirky: Situated Software [[hypothesis]]

doesn't work on archive.org pages??

* tantivy [[tantivy]]

Search indexer on Rust
https://github.com/tantivy-search/tantivy
related #search

Try search as you type on Wikipedia [[tantivy]]

https://github.com/tantivy-search/tantivy-cli#indexing-the-document-index

host wikipedia backend for a bit and give a frontend link to github issue [[tantivy]]

tantivy-py: need to bump version to -dev or something? [[tantivy]]

* twint [[twint]]

related: #twitter

not sure about –profile-full?? [[twint]]

twint -u karlicoss --database tweets3.db --profile-full

hmm. it looks like it can't parse tweet ids?? [[twint]]

CRITICAL:root:twint.get:Tweet:time data '' does not match format '%Y-%m-%d %H:%M:%S'
1249982874150932480 2020-04-14 09:48:35 BST <karlicoss> I love it, one of the best physics textbooks I know ! Will probably take  years for me to fully grasp, but it's very pleasant to read! https://twitter.com/JakobSchwich/status/1249569424622878720 …
1249856617031630848 2020-04-14 01:26:53 BST <karlicoss> I'm almost sure you've seen it, but this is a fascinating read:  https://slatestarcodex.com/2014/03/17/what-universal-human-experiences-are-you-missing-without-realizing-it/ … (comments too!)
1249820865593847814 2020-04-13 23:04:49 BST <karlicoss> It's probably for the first time in years when I actually liked some user interface. Wow.
1249820017576890368 2020-04-13 23:01:27 BST <karlicoss> Wow, I've just used @liberapay for the first time, and it's been *increadibly* pleasant.  Clean, functional and text-centered interface. No bullshit, you can clearly see who you pay, how and when.
CRITICAL:root:twint.get:Tweet:time data '' does not match format '%Y-%m-%d %H:%M:%S'
CRITICAL:root:twint.get:Tweet:time data '' does not match format '%Y-%m-%d %H:%M:%S'
1249586565417963520 2020-04-13 07:33:48 BST <karlicoss> this is, in part, why I stopped listening podcasts

`[2020-04-13]` Show HN: Twint – Twitter scraping tool written in Python | Hacker News [[twint]] [[promnesia]] [[hpi]]

hmm maybe use it real quick?

`[2020-04-14]` Home · twintproject/twint Wiki [[hpi]]

maybe use github wiki?

* org-sync

https://github.com/arbox/org-sync
syncing #github issues with #org mode
using #gitbug instead now

`[2019-12-27]` not sure if I like sorting by modified time… OPEN and id is better [[orgsync]]

`[2020-04-12]` for org-sync thing – could keep private notes in a separate file, but link into ids? [[github]]

--

share link and content [[tusky]]

`[2020-01-25]` https://github.com/tuskyapp/Tusky/issues/1655

validate systemd? [[pyinfra]]

ncmpcpp file name too long [[mpd]]

годы пройдут часть 1

update miniflux docs, mention that `CLEANUP_ARCHIVE_READ_DAYS` docs

https://github.com/miniflux/miniflux/blob/f9a773ab18815a57e74bedc243ede1ad70e89917/storage/entry.go#L224

PR in toastify for innerHTML

`[2019-09-08]` Validate inputs before saving · Issue #2 · fregante/webext-options-sync

https://github.com/fregante/webext-options-sync/issues/2

problem with escaping table name [[visidata]]

/usr/lib/python3/dist-packages/visidata/loaders/sqlite.py

 def reload(self):
    tblname = self.tableName
    self.columns = self.getColumns(tblname)
    r = self.conn.execute('SELECT COUNT(*) FROM "%s"' % tblname).fetchall()
    rowcount = r[0][0]
    self.rows = []
    for row in Progress(self.conn.execute('SELECT * FROM "%s"' % tblname), total=rowcount-1):
        self.addRow(row)

def getColumns(self, tableName):
    cols = []
    for i, r in enumerate(self.conn.execute('PRAGMA TABLE_INFO("%s")' % tableName)):

Allow users to mark posts as searchable/not searchable? [[mastodon]]

`[2020-12-11]` Export annotations - ⭐️Feature Requests - Memex Community [[worldbrain]]

Here is a guide on how to use the StorexHub API to get your Memex annotations.
It’s still in developer alpha, so it will require Javascript knowledge in building something useful:
https://worldbrain.github.io/storex-docs/#/storex-hub/guides/memex/?id=use-case-3-importexport-data-on-demand 12

sigh.. it's a bit overcomplicated
really need a simple json export..

⥅ node [[fan]] pulled by Agora

📓 garden/flancian/fan.md by @flancian

fan

I am a fan of [[things]].
- [[pull]] [[gnu]] [[linux]] [[eff]] [[gnu]] [[wikis]] [[agora]]

⥅ node [[fbi]] pulled by Agora

📓 garden/neil/fbi.md by @neil

FBI

⥅ node [[fep]] pulled by Agora

📓 stoa/doc.anagora.org/fep.md by @anonymous@doc.anagora.org

⥅ node [[foo]] pulled by Agora

📓 garden/flancian/foo.md by @flancian

Foo

A [[metavariable]] in common use by [[programmers]] and [[nerds]].
- I use this node as an example occasionally through the [[agora]].
[[go]] https://en.wikipedia.org/wiki/Foobar
[[bar]] https://en.wikipedia.org/wiki/Metasyntactic_variable

⥅ node [[for]] pulled by Agora

📓 garden/flancian/for.md by @flancian

an [[album]]
- by [[kate nv]]
- [[spotify]] https://open.spotify.com/album/2Z0F9mcg3jFPr6nyhNwMm9?highlight=spotify:track:22YcziSTG15GKYTYDKhlRV
  - [[go]] [[spotify]]

⥅ node [[fp]] pulled by Agora

📓 garden/karlicoss/programming/fp.md by @karlicoss

[2016-06-20] What is functional programming?
[[Free monads]] [[monad]]
[2016-10-24] Kleisli monads [[monad]]
[2016-02-05] type classes: downcasting and instanceof are impossible!
[2016-09-25] parametricity
[2016-08-07] semantics
[[related]] [[programming]] [[haskell]] [[typetheory]]
[2015-06-20] foldl vs foldr [[fp]]
[2015-06-20] let polymorphism http://stackoverflow.com/a/12033549/706389 [[fp]]
[2021-01-01] Bartosz Milewski (@BartoszMilewski): "Starting the new year with a new project: The Dao of Functional Programming. Here's a short intro." | nitter
[2018-11-27] Pinboard: bookmarks for karlicoss tagged 'fp' [[fp]]
[2016-02-28] Existential types [[haskell]]
[2016-02-28] Haskell version of Yoneda lemma [[yoneda]] [[haskell]]

`[2016-06-20]` What is functional programming?

First-class and higher-order functions
Pure functions
Recursion (as a consequence of pure functions?)
Strict versus non-strict evaluation
Type systems

When do you choose functional programming over object oriented? When you anticipate a different kind of software evolution:

Object-oriented languages are good when you have a fixed set of operations on things, and as your code evolves, you primarily add new things. This can be accomplished by adding new classes which implement existing methods, and the existing classes are left alone.

Functional languages are good when you have a fixed set of things, and as your code evolves, you primarily add new operations on existing things. This can be accomplished by adding new functions which compute with existing data types, and the existing functions are left alone.

When evolution goes the wrong way, you have problems:
- Adding a new operation to an object-oriented program may require editing many class definitions to add a new method.
- Adding a new kind of thing to a functional program may require editing many function definitions to add a new case.

Free monads [[monad]]

http://www.parsonsmatt.org/2017/09/22/what_does_free_buy_us.html good tutorial with examples
https://markkarpov.com/post/free-monad-considered-harmful.html

`[2016-10-24]` Kleisli monads [[monad]]

Earlier I said that the key to a monad is its Kleisli arrows. The reason why is that Kleisli arrows are morphisms in the Kleisli category, where (>=>) is Kleisli arrow composition:

(>=>) :: (Monad m) => (a -> m b) -> (b -> m c) -> (a -> m c)
(f >=> g) x = f x >>= g
.. and return is the identity:
return :: (Monad m) => a -> m a

Like all categories, the Kleisli category must obey the category laws:

return >=> f = f                   -- Left identity
f >=> return = f                   -- Right identity
(f >=> g) >=> h = f >=> (g >=> h)  -- Associativity

`[2016-02-05]` type classes: downcasting and instanceof are impossible!

`[2016-09-25]` parametricity

In a parametric language the presence of a universally quantified type variable intuitively conveys a very strong guarantee: A (part of a) value passed to a parametric polymorphic function in the position of a type variable is guaranteed only to be copied and moved around, but never inspected in the function

`[2016-08-07]` semantics

Denotational semantics: natural, maps to mathematical domains
Operational semantics: describes execution on an abstract machine

Small step / big step

Denotational semantics is similar to high-level operational semantics, except:

Machine is gone
Language is mathematics (lambda calculus)

The difference between denotational and operational semantics:

In operational semantics, the state changes are defined by coded algorithms for a virtual machine
In denotational semantics, they are defined by rigorous mathematical functions

related [[programming]] [[haskell]] [[typetheory]]

`[2015-06-20]` foldl vs foldr [[fp]]

-- Left fold:
foldl :: (a -> b -> a) -> a -> [b] -> a
foldl f z []   = z
foldl f z (x:xs) = foldl f (f z x) xs

-- Tail recurstion, but recurses forever if the list is infinite.
-- Might cause OOM due to enormous thunks.

foldl' : strict version
foldl' :: (a -> b -> a) -> a -> [b] -> a
foldl' f !z [] = z
foldl' f !z (x: xs) = foldl' f (f z x) xs

-- Right fold:
foldr :: (a -> b -> b) -> b -> [a] -> b
foldr f z []     = z
foldr f z (x:xs) = f x (foldr f z xs)

foldr: under lazy evaluation, may stop early and thus can deal with infinite lists.
Might cause OOM: foldr (+) 0 [1..1000000]

TODO: internal thunk stack?

`[2015-06-20]` let polymorphism http://stackoverflow.com/a/12033549/706389 [[fp]]

We might want to define
let x = expr in t
as (\x.t) expr

We've got to assign a concrete type to f (TODO why?), which means it can't be forall a.a -> a

Instead, we define it as a primitive:

\Gamma \vdash expr: S; \Gamma \vdash t[x -> expr]: T
----
\Gamma \vdash let x = expr in t: T

\Gamma vdash expr:S to assure typability of expr at all.

A key insight in this matter is that rather than just typing a lambda-abstraction with a potentially polymorphic argument type, we are typing a (sugared) abstraction that is (1) applied exactly once and, moreover, that is (2) applied to a statically known argument. That is, we can first subject the "argument" (i.e. the definiens of the local definition) to type reconstruction to find its (polymorphic) type; then assign the found type to the "parameter" (the definiendum); and then, finally, type the body in the extended type context.

Basically, we can write polymorphic functions, but can't use arguments in polymorphic way.

Note that it's perfectly possible to pass a polymorphic function as an argument to another function. So something like map id ["a","b","c"] is perfectly legal. But the function may only use it as monomorphic. In the example map uses id as if it had type String -> String

`[2021-01-01]` Bartosz Milewski (@BartoszMilewski): "Starting the new year with a new project: The Dao of Functional Programming. Here's a short intro." | nitter

Starting the new year with a new project: The Dao of Functional Programming. Here's a short intro.

`[2018-11-27]` Pinboard: bookmarks for karlicoss tagged 'fp' [[fp]]

https://pinboard.in/u:karlicoss/t:fp

`[2016-02-28]` Existential types [[haskell]]

data Obj = forall a. (Show a) => Obj a

xs :: [Obj]
xs = [Obj 1, Obj "foo", Obj 'c']

doShow :: [Obj] -> String
doShow [] = ""
doShow ((Obj x):xs) = show x ++ doShow xs

Dynamic dispatch:

 class Shape_ a where
   perimeter :: a -> Double
   area      :: a -> Double

 data Shape = forall a. Shape_ a => Shape a

 type Radius = Double
 type Side   = Double

 data Circle    = Circle    Radius
 data Rectangle = Rectangle Side Side
 data Square    = Square    Side


 instance Shape_ Circle where
   perimeter (Circle r) = 2 * pi * r
   area      (Circle r) = pi * r * r

 instance Shape_ Rectangle where
   perimeter (Rectangle x y) = 2 * (x + y)
   area      (Rectangle x y) = x * y

 instance Shape_ Square where
   perimeter (Square s) = 4*s
   area      (Square s) = s*s

 instance Shape_ Shape where
   perimeter (Shape shape) = perimeter shape
   area      (Shape shape) = area      shape

-- Smart constructor:

 circle :: Radius -> Shape
 circle r = Shape (Circle r)

 rectangle :: Side -> Side -> Shape
 rectangle x y = Shape (Rectangle x y)

 square :: Side -> Shape
 square s = Shape (Square s)

 shapes :: [Shape]
 shapes = [circle 2.4, rectangle 3.1 4.4, square 2.1]

`[2016-02-28]` Haskell version of Yoneda lemma [[yoneda]] [[haskell]]

forall r . ((a -> r) -> f r) ~ f a, where f is a functor

Concrete example:

fun :: forall r . ((Bool -> r) -> [r]

How many different implementations of fun are there? As many as there are lists of Bools.

⥅ node [[fs2]] pulled by Agora

📓 garden/s5bug/fs2.md by @s5bug

fs2

https://fs2.io
A [[Scala]] library that allows abstracting data transmission and control into a shared concept called a Stream.

⥅ node [[fsm]] pulled by Agora

📓 garden/flancian/fsm.md by @flancian

FSM

Finite state machines. A computation abstraction level that I find particularly appealing for some reason.

⥅ node [[fud]] pulled by Agora

📓 garden/flancian/fud.md by @flancian

FUD

Fear, Uncertainty, Doubt.
A disinformation strategy.
Also, incidentally, a trigger for [[procrastination]].

⥅ node [[g-]] pulled by Agora

📓 garden/flancian/g..md by @flancian

G.

A [[person]].
He's also trying [[Learning to Learn]]
[[Gift idea]]: yoga mats x2
Could do a semester abroad in [[fribourg]] or [[paris]].
In [[think tank]]: [[CRAS]].
Interested in:
- [[huerta común]]
- [[hydrogen batteries]]
  - green > blue > grey

[[2020-11-28]]

Reunión con empresa que está tratando de desarrollar motores de hidrógeno, pero necesita financiación y homologación.
- Desarrollan celdas que van en motores de combustión.
Existen empresas de [[triple impacto]].
- Se ocupan en ganar dinero, pero también de ser amigables con el medio ambiente y con el entorno social.
Existen [[empresas B]].
- Tienen objetivos relacionados con el bien público.
[[GPL]] vs [[Apache]] / [[MIT]]
- Definiciones de libertad.
- [[paradoja de la tolerancia]]: el autoritario clama por la libre expresión, pero en un sistema libre todas las opiniones deben tolerarse salvo las autoritarias.
Fundaciones, testamentos, ejecutores.
- Designar a un grupo de ejecutores, ellos ejecutan un algoritmo designado en el testamento.

⥅ node [[g-i]] pulled by Agora

📓 garden/flancian/g i.md by @flancian

G. I.

[[pull]] [[g.]]
- Contento con el profesor de Educación y Comunicación Ambiental.
- a [[friend]]

⥅ node [[g20]] pulled by Agora

📓 garden/neil/g20.md by @neil

G20

intergovernmental forum comprising 19 countries and the European Union

– G20 - Wikipedia

composed of most of the world's largest economies, including both industrialized and developing nations.

– G20 - Wikipedia

⥅ node [[gan]] pulled by Agora

📓 garden/KGBicheno/Artificial Intelligence/Introduction to AI/Week 3 - Introduction/Definitions/Gan.md by @KGBicheno

GAN

Go back to the [[AI Glossary]]

Abbreviation for generative adversarial network.

⥅ node [[gc]] pulled by Agora

📓 garden/flancian/gc.md by @flancian

#pull [[garbage collect]] [[garbage collection]]

⥅ node [[gdp]] pulled by Agora

📓 garden/neil/gdp.md by @neil

GDP

Kuznets developed GDP as a means of measuring the impact of the great depression. It enabled governments to track any increase or decrease in their nation’s wealth as represented by the value of goods and services produced, and became increasingly important as governments estimated the cost of waging the second world war.

– Beyond GDP: here’s a better way to measure people’s prosperity

The developer of the concept, Simon Kuznets, didn't think it was a good measure of national welfare. ([[Doughnut Economics]])

Nobel prize-winner Simon Kuznets declared in 1934 that “the welfare of a nation can scarcely be inferred from a measurement of national income”

– Beyond GDP: here’s a better way to measure people’s prosperity

⥅ node [[gig]] pulled by Agora

📓 garden/flancian/gig.md by @flancian

#pull [[gigabyte]] [[gibibyte]]

⥅ node [[git]] pulled by Agora

📓 garden/bmann/_notes/git.md by @bmann

Local Git Exclude

Edit the local exclude file in your git repo without having to edit the global .gitignore

.git/info/exclude

Source: StackOverflow

Counting files in a git repo

git ls-files | wc -l

Source: Stackoverflow

📓 garden/flancian/git.md by @flancian

git

a [[list]].
- of [[repositories]].
- If you [[go/git/project]] in an Agora, you might just land in its well known Git repository (not necessarily [[Github]]).
a [[version control system]].
- by [[linus torvalds]]
- #pull [[git-config]] [[git-alias]] [[git-ship]]
- https://twitter.com/flancian/status/1377588651232800771

📓 garden/jakeisnt/pages/git.md by @jakeisnt

Git is a popular version control system.

Tricks

Writing a Git Commit Message

Article Reference

Concise and consistent length and form
Communicate clear context about a change to fellow developers. Ensure that other developers understand why a change was made.

Rules

Separate subject from body with a blank line if the body is to be used.
Limit subject line to 50 characters
Capitalize subject line
Do not end with period
Use imperative mood; I 'do' this. Rationale: If applied, the commit will change these aspects of the code. Git's own built-in conventions use this form.
Wrap at 72 characters
Use the body to explain 'what' and 'why' as necessary

Organization Thoughts

github organization:

one repo per course - as most courses require partner work

= repo for coding challenge practice problems

managing research notes: ??? i am thinking a single org file for all of this
- that is, an org file in each project for the research notes pertaining to that project,
- and anotherorg file for misc. research ?? i will have to see how my research is used

https://danieltakeshi.github.io/2017/07/15/how-i-organize-my-github-repositories/

Rewriting

It's a good idea to reformat commits to make them more readable.

git reset HEAD~${number of commits to go back}

Tricks

http://joeyh.name/blog/entry/how_to_publish_git_repos_that_cannot_be_republished_to_github/ :: cheeky way to abuse DMCA to avoid GitHub using your Git repos https://sourcehut.org/blog/2020-10-29-how-mailing-lists-prevent-censorship/ using the mailing list model over the built-in issue model, and how this naturally federated and local first procedure is superior to github's standard issue approach https://sagegerard.com/git-debugging.html: use git bisect while referencing maintainers of specific parts of code to narrow down to the code you should care about, then ask the maintainers about it - while putting in a minimum of effort. https://labs.consol.de/development/git/2017/02/22/gitignore.html using .gitignore the right way

Patch previous commits with rebases

https://stackoverflow.com/questions/9103396/how-do-i-edit-a-previous-git-commit If you need to change commit history:

Make another commit to make the change
Rebase starting at the commit you want to change
Squash the new commit with the old one in the history
Remove the second commit message (or merge it…)

This did change the commit time for my latest commit, which is something to watch out for.

How Git Works

Neat writeup on the Git patience diff algorithm "Distributed, offline-first bug tracker embedded in git, with bridges" Prototype Git GUI for Filmmaking "Pull github, bitbucket, and trac issues into taskwarrior" Text-mode interface for git bcongdon/git-trophy: ? Create a 3D Printed Model of Your Github Contributio

Worktrees

A git repository can have multiple working trees - allowing you to check out more than one workspace at a time!
- Among other things, this allows you to work on multiple branches at once without having multiple copies of the file, and maps git branches or tags to other directories on your system. Use it to check on different efforts on projects without messing up your current editing environment - to look at code from other branches locally and simultaneously, for example!
`git worktree add $PATH` :: Adds a new branch with a name associated with the final component of $PATH. `git worktree remove` and `git worktree prune` both allow you to cut off external worktrees.
Flow example: latest develop, latest branch of work, and a third for reviewing pull requests and/or the work from other developers.

Github

track changes to a patch over time git flow: git extensions for high level repository operations explore git cli with natural language search github is sinking

READMEs

A curated list of awesome Github Profile READMEs 📝 https://github.com/pifafu/pifafu/blob/main/readME.md i love the font choice and the gif here!

Code Review

How to do a code review | eng-practices

Alternatives

fossil
git with additional features such as task management. it seems like a superset of git's system. Fossil vs. Git Incrementally converting from git to fossil while working on the git repo

repo
Google's tool for managing monorepos.

Pijul
A distributed version control system

Bazaar
Canonical's version control system

📓 garden/karlicoss/soft/git.md by @karlicoss

[2020-04-19] The Communicative Value of Using Git Well – Math ∩ Programming [[git]]
[2017-05-06] use hg-fast-export to convert [[mercurial]] [[git]]
[2016-09-07] git stores snapshots, not diffs [[git]]
[[NOCOMMIT global hook?]] [[git]]
[2019-08-18] Highlights from Git 2.23 - The GitHub Blog [[git]]
[[Git blame ignore formatting]] [[git]]
[2019-08-24] Fossil Versus Git | Lobsters [[git]]
[[My unorthodox, branchless git workflow | Lobsters]] [[git]]
[[a page with my favourite git commands & tricks?]] [[git]] [[toblog]] [[exobrain]]
[[The Communicative Value of Using Git Well – Math ∩ Programming]] [[git]]
[2019-08-02] git - How do I remove a submodule? - Stack Overflow [[git]]
[2019-12-11] git reflog expire –expire=now –all && git gc –prune=now –aggressive [[github]]
[2019-05-10] git rebase –committer-date-is-author-date –autostash HEAD~1 [[git]]
[2020-06-08] Learn to change history with git rebase!
[2018-11-28] extraction - How to extract one file with commit history from a git repo with index-filter & co - Stack Overflow [[git]]
- [2019-04-10] set up git project commmand
[2020-07-12] - GitHub + why do we centralize issues, documents for a distributed version… | Hacker News
[2018-01-01] detect file type changes [[git]]
[[git ssh debugging]] [[git]] [[ssh]]
[2021-01-11] How to keep your Git history clean with interactive rebase | GitLab
[2020-11-16] Why Git blame sucks for understanding WTF code (and what you should use instead) | Lobsters
[2019-07-21] git - How do I remove a submodule? - Stack Overflow https://stackoverflow.com/questions/1260748/how-do-i-remove-a-submodule/7646931#7646931 [[git]]

`[2020-04-19]` The Communicative Value of Using Git Well – Math ∩ Programming [[git]]

`[2017-05-06]` use `hg-fast-export` to convert [[mercurial]] [[git]]

`[2016-09-07]` git stores snapshots, not diffs [[git]]

Different from SVN
It is important to note that this is very different from most SCM systems that you may be familiar with. Subversion, CVS, Perforce, Mercurial and the like all use Delta Storage systems - they store the differences between one commit and the next.
Git does not do this - it stores a snapshot of what all the files in your project look like in this tree structure each time you commit. This is a very important concept to understand when using Git.
Git’s pack files are carefully constructed to effectively use disk caches and provide “nice” access patterns for common commands and for reading recently referenced objects.

NOCOMMIT global hook? [[git]]

`[2019-08-18]` Highlights from Git 2.23 - The GitHub Blog [[git]]

https://github.blog/2019-08-16-highlights-from-git-2-23/

You may have used git grep to search for some text in your Git project, just as you may have used git diff to view active changes. What do the two have in common? They both display some contents in your repository, and both have support to show the surrounding function context with -p (short for --show-function) or -W (short for --function-context), respectively.

Git blame ignore formatting [[git]]

Configure your git blame to ignore cleanup changes.

https://www.moxio.com/blog/43/ignoring-bulk-change-commits-w…

`[2019-08-24]` Fossil Versus Git | Lobsters [[git]]

https://lobste.rs/s/e3blgf/fossil_versus_git

This article is getting a few things about git wrong. They claim git only supports ‘One check-out per repository’. Heard of git worktree?

My unorthodox, branchless git workflow | Lobsters [[git]]

Git revise is especially useful for this commit stack workflow, as I call it. I’m a huge fan.

It’s a better rebase. So much better that it should be obligatory. You can split commits, batch rename them, and you don’t have to stash your work first.

a page with my favourite git commands & tricks? [[git]] [[toblog]] [[exobrain]]

wsdiff
image diff
nbstirpout
iadd
extra worktree dir

The Communicative Value of Using Git Well – Math ∩ Programming [[git]]

I’ve written up my ideas, under the name ‘Literate Git’, at https://github.com/bennorth/literate-git if you’re interested.
The tool I wrote turns a structured git history into an interactive web page.
There’s an example there of how the ideas might work in a tutorial setting.
After I gave a talk on this work, one of the people in the audience tried it with the Haskell LLVM tutorial: https://lukelau.me/kaleidoscope/

`[2019-08-02]` git - How do I remove a submodule? - Stack Overflow [[git]]

https://stackoverflow.com/questions/1260748/how-do-i-remove-a-submodule/21211232#21211232

git rm the_submodule
rm -rf .git/modules/the_submodule

`[2019-12-11]` git reflog expire –expire=now –all && git gc –prune=now –aggressive [[github]]

`[2019-05-10]` git rebase –committer-date-is-author-date –autostash HEAD~1 [[git]]

`[2020-06-08]` Learn to change history with git rebase!

`[2018-11-28]` extraction - How to extract one file with commit history from a git repo with index-filter & co - Stack Overflow [[git]]

https://stackoverflow.com/questions/7375528/how-to-extract-one-file-with-commit-history-from-a-git-repo-with-index-filter/37037151

git filter-branch --index-filter 'git read-tree --empty; git reset $GIT_COMMIT -- $your $files $here' -- --all --

`[2019-04-10]` set up git project commmand

`[2020-07-12]` - GitHub + why do we centralize issues, documents for a distributed version… | Hacker News

for an academic treatment of the defects in Git read: What's Wrong with Git? A Conceptual Design Analysis S. Perez De Rosso and D. Jackson. In Proceedings of the 2013 ACM International Symposium on New Ideas, New Paradigms, and Reflections on Programming & Software (Onward! 2013)

`[2018-01-01]` detect file type changes [[git]]

for r in *; do pushd $r; git whatchanged | grep "\.\.\..T"; popd; done

git ssh debugging [[git]] [[ssh]]

GIT_SSH_COMMAND='ssh -v' git fetch

`[2021-01-11]` How to keep your Git history clean with interactive rebase | GitLab

`[2020-11-16]` Why Git blame sucks for understanding WTF code (and what you should use instead) | Lobsters

For archeology I really love git gui blame despite its dated UI

`[2019-07-21]` git - How do I remove a submodule? - Stack Overflow https://stackoverflow.com/questions/1260748/how-do-i-remove-a-submodule/7646931#7646931 [[git]]

he majority of answers to this question are outdated, incomplete, or unnecessarily complex.

A submodule cloned using git 1.7.8 or newer will leave at most four traces of itself in your local repo. The process for removing those four traces is given by the three commands below:

📓 garden/melanocarpa/git.myco by @melanocarpa

Git is a [[distributed version control system]]. It stores //whole objects//, not diffs, which is one of the key differences between Git and other version control systems of its time. This [[speeds up operations]] like checking out branches and processing commits in batch. //Distributed// means that while you can have a single source of truth, nothing will break when it goes down, because [[the whole object database is stored on users' machines]], and [[data integrity is easily verified]] (commits can also be signed using OpenPGP).

=> https://git-scm.com | Official website

= Links => https://matrix.to/#/!ORfrUEFeWFcHAMLFLr:matrix.org/$1644101095103BLdVu:grin.hu?via=matrix.org&via=matrix.allmende.io&via=privacytools.io | Matrix message by @grin Péter Gervai:

That is probably an inherent lazyness of me, for example I passionately hate git and pretty much like mercurial, because the first was created by a dozen hackers to themselves, and nobody really understands it, and nobody else can really use it to its full potentials, and all the documentation and help pages are obscure, complex and generally written from the perspective of someone already knowing the system and being pretty annoyed that have to explain it to anyone else; mercurial on th eother hand has an excellend handbook, good structured help system, easy to use commands which can be very complex if someone take the time and efforts to learn it. And both systems are basically the same, do the same, using the same principles. The difference is the attitude towards the people not yet being fluent in the system. Also see: [[https://git-man-page-generator.lokaltog.net/]]

=> https://warmedal.se/~bjorn/posts/2021-09-20-finally-understanding-the-power-of-git.html | Finally Understanding the Power of Git

A platform like Github makes this different, in that it abstracts these tools into a web UI and expect all collaborators to have an account at the platform. The more I learn about ways of collaborating outside of a centralised service like that, the more I've come to dislike them. Decentralised collaboration is a lot more enjoyable and empowering.

=> https://blog.sulami.xyz/posts/cleaning-up-git-history/ | Cleaning Up Git History - sulami's blog

Cleaning up the history might seem tedious at first for marginal cosmetic benefits, but it gets much easier and faster with practice. Here I am collecting some tips for cleaning up a git commit history before publishing it to others, for example in the form of a pull request.

=> https://www.banterly.net/2021/07/31/new-in-git-switch-and-restore/ | New in Git: switch and restore

=> https://martowen.com/2016/05/01/git-submodules-vs-git-subtrees/ | Git Submodules vs Git Subtrees

Submodules are easier to push but harder to pull – This is because they are pointers to the original repository Subtrees are easier to pull but harder to push – This is because they are copies of the original repository

=> https://git-annex.branchable.com/

git-annex allows managing files with git, without checking the file contents into git. While that may seem paradoxical, it is useful when dealing with files larger than git can currently easily handle, whether due to limitations in memory, time, or disk space.

git-annex is designed for git users who love the command line. For everyone else, the git-annex assistant turns git-annex into an easy to use folder synchroniser.

=> https://ladycat.wordpress.com/2020/03/04/flashbake-автосохранение-в-git/ | Flashbake — автосохранение в git

Собственно, по-хорошему, тут надо начинать с того, что есть целая тема — «системы управления версиями», предназначенные вообще-то для программистов, но я уверена, что пишущим — не менее нужные. Из них я уже который год использую git.

=> https://ta180m.exozy.me/posts/gitea-actually-joins-the-fediverse/ | Gitea Actually Joins the Fediverse

Gitea federation development has reached a crucial milestone: federating with Mastodon! This is a //big deal//.

📓 garden/neil/git.md by @neil

Git

⥅ node [[gnu]] pulled by Agora

📓 garden/flancian/gnu.md by @flancian

gnu

a [[project]].
- I am a huge fan of the [[gnu project]].
- [[go]] https://gnu.org

📓 garden/neil/gnu.md by @neil

GNU

⥅ node [[go]] pulled by Agora

📓 garden/flancia.org/pages/go.md by @flancia.org

I run a lightweight implementation of Go Links on the /go/ URL space. Basically anything under https://flancia.org/go/ is a redirect to a URL somewhere on the internet. Think of it as open, lightweight social bookmarking.

The Go Links idea is very popular in many companies. It originated at Google. I think it might catch on in the wider internet as well.

If you'd like to implement Go Links on your domain, there's two ways I could currently recommend. Read on.

Use HTTP redirects.

The geekier way. Simplest and quickest to set up if you like stuff like writing your own Apache/Nginx configs. Basically just set up redirects in /go/, done.

TODO: link my live nginx configuration/redirect list?

Use Trotto Go Links.

See https://flancia.org/go/trotto :)

📓 garden/flancian/go.md by @flancian

Go

An [[action]].
- A [[go link]] is a [[canonical result]] for a [[search query]].
- A [[go link]] is a [[url]] which is [[relevant]] for the task at hand.
- If the [[agora]] sees a block in your notes that links to the 'go' node followed by a [[URL]], as per the example below, it will redirect users to the URL when they invoke the action.
- See also: [[agora-go-links-integration]].
To browse every [[go link]] in the [[agora]], see [[backlinks]] below.
[[go]] flancia.org/mine/go-links
- The above block results in the Agora creating a [[go link]] for the node id in which it is in ('go'), redirecting to the URL that appears after the action.
- Concretely, if you visit anagora.org/go/go you will be redirected to flancia.org/mine/go-links.
- This, I believe, can be a sufficient substrate for implementing [[social bookmarking]] and [[social search]].
[[twitter]] https://twitter.com/flancian/status/1330572022146019328.

📓 garden/luciana/go.md by @luciana

go

📓 garden/vera/go.md by @vera

an [[ancient game]]
the [[golang]] programming language

⥅ node [[god]] pulled by Agora

📓 garden/bbchase/book notes/God.md by @bbchase

Author:: [[Reza Aslan]]
Full Title:: God
Category:: [[books]]
Highlights first synced by [[readwise]] [[September 2nd, 2020]]
- For when we endow God with human attributes, we essentially divinize those attributes, so that everything good or bad about our religions is merely a reflection of everything that is good or bad about us. Our desires become God’s desires, but without boundaries. Our actions become God’s actions, but without consequence. We create a superhuman being endowed with human traits, but without human limitations. We fashion our religions and cultures, our societies and governments, according to our own human urges, all the while convincing ourselves that those urges are God’s. (Location 116)

📓 garden/flancian/god.md by @flancian

God

[[go]] en.wikipedia.org/wiki/God

https://twitter.com/flancian/status/1375501181779329024

⥅ node [[gtd]] pulled by Agora

📓 garden/flancian/gtd.md by @flancian

GTD

📓 garden/neil/gtd.md by @neil

GTD

⥅ node [[gui]] pulled by Agora

📓 garden/melanocarpa/gui.myco by @melanocarpa

Graphical User Interface is a type of interface that has many graphics. Usually, it involves various metaphors, such as //desktop// or //window//. All modern consumer computers have GUIs, because it is thought people have little problems understanding them.

= Links

=> https://warmedal.se/~bjorn/posts/2021-11-19-lightweight-simple-and-cross-platform-gui-programming.html | Björn: Lightweight, Simple, and Cross-Platform GUI Programming?

Can you recommend me a better GUI programming tool that fulfills my requirements? I know Qt has some sort of XML-like markup these days, but is it easier to develop in and lighter or faster than tkinter?

=> https://felix.plesoianu.ro/blog/gui-dialog.html | In dialog with a GUI

As the name suggests, Xdialog is a graphical clone of its text-based counterpart, that tries hard to be compatible (and the other way around). Sadly, its latest version is so old it uses Gtk 1.2! Good luck finding either packaged for a modern Linux distribution.

A more reliable option is Zenity, that's part of Gtk3 and usually preinstalled along with it. It has simplified command line options compared to (X)dialog, but in return features modern controls like a tabular list and desktop notifications. It also makes it much easier to use forms, for example. Plus, certain controls can receive their data on standard input and thus handle a lot more than if it came from the command line. ...

Last but not least, there's yad, a fork of Zenity with more controls, more field types and so on. Its last release was more than four years ago, but that's not a problem just yet.

=> https://www.youtube.com/watch?v=YThelfB2fvg | Mouse Cursor History (and why I made my own) [YT]

=> https://nixers.net/Thread-Historical-GUI-Websites | Historical GUI Websites — Nixers forum

=> https://maggieappleton.com/programming-portals | Programming Portals Some cool screenshots here

⥅ node [[guo]] pulled by Agora

📓 garden/flancian/guo.md by @flancian

a [[person]]
- [[push]] [[matters news]]
  - [[go]] https://matters.news/
- [[pull]] [[hypha]]

⥅ node [[h1]] pulled by Agora

📓 garden/flancian/Library/Core/Snippet/h1.md by @flancian

⥅ node [[h2]] pulled by Agora

📓 garden/flancian/Library/Core/Snippet/h2.md by @flancian

⥅ node [[h3]] pulled by Agora

📓 garden/flancian/Library/Core/Snippet/h3.md by @flancian

⥅ node [[h4]] pulled by Agora

📓 garden/flancian/Library/Core/Snippet/h4.md by @flancian

⥅ node [[hmu]] pulled by Agora

📓 garden/flancian/hmu.md by @flancian

a [[thread]] :)
- [[feature request]].
- #go https://github.com/flancian/agora-bridge/issues/9

⥅ node [[hn]] pulled by Agora

📓 garden/flancian/hn.md by @flancian

HN

[[go]] news.ycombinator.com
[[pull]] [[Hacker News]]
A classic in the tech worker/venture capitalist scene, strong focus on [[silicon valley]] but relevant worldwide.
Sometimes feels like a satire of itself, but overall the community quality remains high due to highly involved moderation and stringent rules on contribution quality.
[[agora hn]] I posted the [[agora]] to HN on [[2020-12-29]]: https://news.ycombinator.com/item?id=25573523

⥅ node [[hpi]] pulled by Agora

📓 garden/flancian/hpi.md by @flancian

hpi

a [[project]]
- by [[karlicoss]]
- [[go]] [[git]]
- [[git]] https://github.com/karlicoss/HPI
- [[quote]] TLDR: I’m using HPI (Human Programming Interface) package as a means of unifying, accessing and interacting with all of my personal data. The package hides the gory details of locating data, parsing, error handling and caching. You simply ‘import’ your data and get to work with familiar Python types and data structures.

📓 garden/karlicoss/projects/hpi.md by @karlicoss

The repository: karlicoss/HPI and blog post.

This is a sort of todo-list with raw ideas and things not (yet?) worthy of github issues.

[* similar projects & efforts](#smlrprjctsffrts TIDDLYLINK)
[* 3rd party integrations](#rdprtyntgrtns TIDDLYLINK)
[* documentation & user friendliness improvements](#dcmnttnsrfrndlnssmprvmnts TIDDLYLINK)
- [[Add data arbitration example for twitter]] [[toblog]]
- [[overlay/extension docs: document how to 'overlay' parts of it? with RSS or twitter as examples]]
- [[specify export formats in docstrings and autogenerate?]]
- [[doctor diaginfo command?]]
- [[config: improve config helper to warn about the attributes?]]
- [doc: core primitive: get_files](#dccrprmtvgtfls TIDDLYLINK)
- [2021-02-26] karlicoss (ex. jestem króliczkiem) on Twitter: "@nikitavoloboev I guess if I decide on some opinionated defaults it could just be a single container/VM (maybe you'd need to specify the path to data on disk and that's it). After that maybe people can decide whether they are happy with the defaults or are willing to tweak." / Twitter [[hpi]] [[dashboard]] [[promnesia]]
- [[readme: keep list of packages other people forked? suggest to send me links]]
- [2020-11-10] User workflow documentation / understanding how components fit together · Issue 125 · karlicoss/promnesia
- [[list supported providers in readme]]
- [[Add check methods to each provider, expose in doctor]]
- [2020-05-18] HPI/SETUP.org at master · karlicoss/HPI
- [2020-05-08] intake.github.io/status https://intake.github.io/status [[inspiration]]
- [[doc: I guess google takeout would be a good demonstration]]
- [mention that using make_config isn't even necessary if you're not using default attributes](#mntnthtsngmkcnfgsntvnncssryfyrntsngdfltttrbts TIDDLYLINK)
- [[doc: giude with pyenv if they don't want to mess up their main environment, use docker]] [[hpi]]
- [[add a doctor shortcut for profiling?]]
- [avoid make_config as far as possible, and just use properties directly instead?? it's only necessary for truly complicated hackery](#vdmkcnfgsfrspssblndjstspryncssryfrtrlycmplctdhckry TIDDLYLINK)
- [doc: when I add strict mode, suggest HPI_STRICT=true in troubleshooting guide?](#dcwhnddstrctmdsggsthpstrcttrntrblshtnggd TIDDLYLINK) [[hpi]]
- update doc about using hpi install [--user] my.modulename [[hpi]]
- [[eh, doctor doesn't give meaningful res when running in /data/hpi??]]
- [2019-12-24] inspiration: hugginn credentials inspiration:
- [[doc: Hmm i wonder if egg links can be used on systems without symlinks?]] [[pip]] [[python]]
[* patterns for writing concise and safe modules](#pttrnsfrwrtngcncsndsfmdls TIDDLYLINK)
[* data providers/sources](#dtprvdrssrcs TIDDLYLINK)
[* improving testing & CI](#mprvngtstngc TIDDLYLINK)
[* publicity & reaching out to other people](#pblctyrchngttthrppl TIDDLYLINK)
- [[describe what I've done by the commit history? and comments etc]] [[toblog]]
- [[one of the goals is demonstraing the **architecture**]] [[toblog]]
- [[planetpython etc?]] [[publish]]
- [2021-02-15] (6) InfluxData (@InfluxDB) / Twitter [[hpi]] [[publish]]
- [[about endomondo shutting down and using runnerup for workouts, show the commits]] [[hpi]] [[tweet]] [[outbox]]
- [[publish the thing about HPI configs?]] [[hpi]] [[toblog]]
- [[tweet about hpi + photos integration]] [[hpi]] [[totweet]] [[outbox]]
[* enhancements](#nhncmnts TIDDLYLINK)
[* bugs/issues](#bgssss TIDDLYLINK)
- [[github issues]]
- [[windows compatibility..]] [[hpi]]
- [hmm, iterator in iter_tzs never exhausts? cause it doesn't go over the last year. so it won't cache things??](#hmmtrtrntrtzsnvrxhstscstdntgvrthlstyrstwntcchthngs TIDDLYLINK)
- [MY_CONFIG should resolve path to absolute?](#mycnfgshldrslvpthtbslt TIDDLYLINK)
- [[tzabbr hack attempt]]
- [[doctor: for compileall check need to use tmp path?]] [[hpi]]
- [[hmm stats look a bit off?]] [[hpi]]
- [[this is when forget parens after @cachew]] [[hpi]]
[* misc](#msc TIDDLYLINK)
[[--]]
[[classify modules by ease of setup?]] [[hpi]]
[[I'm not inventing anything new – trying to apply simplicity, decomposition and resilience principles]] [[hpi]]
[[ids are useful to mark some stuff as public (e.g. annotations)]] [[hpi]] [[memex]]
[[could implement some helper that prompts visidata for column types]] [[visidata]] [[hpi]]

* similar projects & efforts

`[2020-01-17]` Chatistics | Python scripts to parse your Messenger, Hangouts, WhatsApp and Telegram chat logs into DataFrames

pretty nice format; perhaps I should do that?

`[2020-03-21]` KrauseFx/FxLifeSheet: Tracking the key metrics of my life [[qs]]

wow, that looks quite elaborate and cool!

`[2019-12-11]` Solid (web decentralization project) - Wikipedia [[solid]]

Solid (Social Linked Data)[1] is a web decentralization project led by Tim Berners-Lee, the inventor of the World Wide Web, developed collaboratively at the Massachusetts Institute of Technology (MIT). The project "aims to radically change the way Web applications work today, resulting in true data ownership as well as improved privacy"[2] by developing a platform for linked-data applications that are completely decentralized and fully under users' control rather than controlled by other entities. The ultimate goal of Solid is to allow users to have full control of their own data, including access control and storage location. To that end, Tim Berners-Lee formed a company called Inrupt to help build a commercial ecosystem to fuel Solid.

`[2019-12-18]` ErikBjare/chatalysis: Analyse (group)chat messages

Currently supports: Facebook Messenger. Planned: Slack, WhatsApp, Telegram, Signal, Wire

`[2020-05-08]` How this site works | Jack Reid [[hpi]]

`[2020-05-18]` Quarantine Notes - Week 10 | Ben Congdon

This probably warrants its own post, but I strongly agree with the philosophy of Dogsheep: everything lives in a SQLite database (that you own!), each exporter tool is its own separate CLI, and Datasette is an extremely flexible tool to explore data. The Dogsheep ecosystem is totally self-hosted (you own your data) and free (as in beer), unlike personal data aggregator platforms like Exist.io and Gyroscope.

`[2021-02-28]` Archivers [[hpi]]

`[2021-03-19]` LifeScope [[qs]] [[dashboard]] [[hpi]]

https://github.com/LifeScopeLabs

need to outreach solid etc [[social]] [[hpi]]

* 3rd party integrations

`[2020-05-14]` could caption "HPI meets X" [[toblog]]

`[2021-02-04]` Apache Arrow 3.0 | Hacker News [[hpi]]

Not only in between processes, but also in between languages in a single process. In this POC I spun up a Python interpreter in a Go process and pass the Arrow data buffer between processes in constant time. https://github.com/nickpoorman/go-py-arrow-bridge

hmm would be pretty cool if possible to use

`[2020-03-18]` ricklamers/gridstudio: Grid studio is a web-based application for data science with full integration of open source data science frameworks and languages [[pandas]]

hmm, looks interesting, but it's all dockerized, so might be tricky to expose my data..

`[2020-05-09]` Live demo · andrey-utkin/taskdb Wiki

it is pretty neat already for analysis with querying and visualization. But your stuff is orders of magnitude bigger. Possibly I will set up HPI for myself some day.

`[2020-09-11]` Kate on Twitter: "I made a super simple CLI plotting thingy, reads numbers on stdin, draws svg to stdout. Just for seeing the shape of data. It's written in awk. https://t.co/TFYKbn2SKT" / Twitter [[tui]]

made a super simple CLI plotting thingy, reads numbers on stdin, draws svg to stdout

`[2021-02-08]` Bram Wiepjes / baserow · GitLab [[hpi]] [[exobrain]]

Open source online database tool and Airtable alternative.

Hpi to anki interface? [[hpi]] [[srs]]

That way would be able to easily import and remember lots of tgings. Just need stable IDs..

def try redash, seems to be a 'free' interface?? [[influxdb]]

https://news.ycombinator.com/item?id=13597068

https://news.ycombinator.com/item?id=23860281

I evaluated on-premise Redash as an alternative for engineers and analysts who don't want to learn tableau. It's harder to setup than Metabase but more intuitive to use (for someone with SQL expertise).

`[2020-10-31]` Welcome to pyspread | pyspread [[hpi]] [[python]] [[spreadsheets]]

pyspread expects Python expressions in its grid cells, which makes a spreadsheet specific language obsolete. Each cell returns a Python object that can be accessed from other cells. These objects can represent anything including lists or matrices.

`[2020-01-10]` Repl.it - Feed https://repl.it/talk/all?lang=python_turtle [[project]] [[promnesia]] [[demo]]

Repl from Repo
Instantly run any GitHub repository.

`[2020-10-16]` Need your insights on a “Self Data Hub” ideation - Quantified Self / Apps & Tools - Quantified Self Forum

hook it right into open humans

`[2020-02-03]` Foreign data wrappers - PostgreSQL wiki [[hpi]]

Twitter

[[observable]]

trying out visidata [[visidata]]

ok looks promising

tried https://www.visidata.org/docs/graph/ on bluemaestro

from my.bluemaestro import dataframe
df = dataframe()
import visidata
visidata.view_pandas(df.reset_index()[-1000:])

for all points, it was pretty slow… not sure why

demo: def need demonstration with Memacs… [[memacs]]

`[2019-12-20]` Datasette — Datasette documentation tool for exploring data?

https://datasette.readthedocs.io/en/stable
Datasette is a tool for exploring and publishing data. It helps people take data of any shape or size and publish that as an interactive, explorable website and accompanying API.
Datasette is aimed at data journalists, museum curators, archivists, local governments and anyone else who has data that they wish to share with the world.

demo: with QS ledger: should be easy it is to integrate [[qs]] [[toblog]]

e.g. https://github.com/markwk/qs_ledger/blob/master/instapaper/instapaper_data_analysis.ipynb
or lastfm ipynb?

`[2021-01-01]` List Of Virtual Tables [[sqlite]]

A virtual table is an object that presents an SQL table interface but which is not stored in the database file, at least not directly. The virtual table mechanism is a feature of SQLite that allows SQLite to access and manipulate resources other than bits in the database file using the powerful SQL query language.

use gephi as frontend?

`[2020-12-14]` Simon Willison (@simonw): "sqlite-utils 3.1 adds a new command: sqlite-utils analyze-tables my.db It queries every column of every table and outputs useful statistics about them: https://sqlite-utils.readthedocs.io/en/stable/changelog.html#v3-1" | nitter [[hpi]]

sqlite-utils 3.1 adds a new command:
    sqlite-utils analyze-tables my.db
It queries every column of every table and outputs useful statistics about them

`[2021-02-14]` influxdata/influxdb-python: Python client for InfluxDB [[influx]] [[pandas]] [[hpi]]

Additional dependencies are:
    pandas: for writing from and reading to DataFrames (http://pandas.pydata.org/

hmm this is useful.. wonder if could benefit from it

`[2020-06-16]` A Jupyter Kernel for SQLite [[hpi]]

https://blog.jupyter.org/a-jupyter-kernel-for-sqlite-9549c5dcf551

grafana is good for gaps in data? [[grafana]] [[hpi]]

`[2020-05-08]` heedy/heedy: An Open-Source Platform for Quantified Self & IoT [[qs]]

Make simplified data projections, so plots can be generated in couple of pandas commands [[toblog]] [[dashboard]]

`[2021-02-11]` Repl.it - Hosting Apps with Always On [[hpi]] [[promnesia]] [[computing]]

As a reminder, Replit gives you most of what you need to rapidly build and ship apps in the cloud -- at lightning speed:
    A blazing fast online IDE
    Automatic Package Management
    Automatic hosting
    Automatic SSL/HTTPS
    Domain linking
    A simple and fast Database for persistence
    A secure way to store secrets

`[2020-10-15]` wger-project/wger: Self hosted FLOSS fitness/workout and weight tracker written with Django [[exercise]]

integrate with it?

HPI should be able to generate blueprints for grafana; maybe even send to the API? [[hpi]] [[grafana]]

e.g. depending on the 'aspects' the data provider has, would be different plots/dashboards

maybe load all to postgres? would also work nice with #cachew …. [[hpi]] [[grafana]]

ok, guess I need to figure out a nice interface to connect to grafana? [[grafana]] [[hpi]]

upload stats; with coverage? [[emfit]] [[grafana]]

`[2020-01-29]` Typesense: Open-Source Alternative to Algolia [[hpi]] [[search]]

https://github.com/typesense/typesense

`[2021-03-05]` Simon Willison (@simonw) / Twitter [[hpi]]

finally need to cooperate with datasette…

* documentation & user friendliness improvements

Add data arbitration example for twitter [[toblog]]

overlay/extension docs: document how to 'overlay' parts of it? with RSS or twitter as examples

e.g.
maybe it's more of a platform to build your own layers etc
akin to spacemacs/doom

specify export formats in docstrings and autogenerate?

doctor diaginfo command?

dump if install is editable or not
os/python version?

config: improve config helper to warn about the attributes?

    return previsits_to_history(*args, **kwargs, src='whatever')[0] # TODO meh
src/promnesia/common.py:333: in previsits_to_history
    previsits = list(extr()) # TODO DEFENSIVE HERE!!!
src/promnesia/sources/takeout.py:105: in index
    from my.google.takeout.paths import get_takeouts
    from dataclasses import dataclass
    from ...core.common import Paths

    from my.config import google as user_config
    @dataclass
>   class google(user_config):
        '''
        Expects [[https://takeout.google.com][Google Takeout]] data.
E       TypeError: no positional arguments expected

doc: core primitive: `get_files`

can handle all sorts of things

`[2021-02-26]` karlicoss (ex. jestem króliczkiem) on Twitter: "@nikitavoloboev I guess if I decide on some opinionated defaults it could just be a single container/VM (maybe you'd need to specify the path to data on disk and that's it). After that maybe people can decide whether they are happy with the defaults or are willing to tweak." / Twitter [[hpi]] [[dashboard]] [[promnesia]]

readme: keep list of packages other people forked? suggest to send me links

`[2020-11-10]` User workflow documentation / understanding how components fit together · Issue 125 · karlicoss/promnesia

list supported providers in readme

Add check methods to each provider, expose in doctor

`[2020-05-18]` HPI/SETUP.org at master · karlicoss/HPI

~/.config/my/my/config.py

eh. not sure about this section…
can't have config/repos dir and config.py at the same time

`[2020-05-08]` intake.github.io/status https://intake.github.io/status [[inspiration]]

doc: I guess google takeout would be a good demonstration

mention that using `make_config` isn't even necessary if you're not using default attributes

also default attributes are pretty important because of caching, error handling policies, etc

doc: giude with pyenv if they don't want to mess up their main environment, use docker [[hpi]]

add a doctor shortcut for profiling?

avoid `make_config` as far as possible, and just use properties directly instead?? it's only necessary for truly complicated hackery

doc: when I add strict mode, suggest HPI_STRICT=true in troubleshooting guide? [[hpi]]

update doc about using `hpi install [--user] my.modulename` [[hpi]]

eh, doctor doesn't give meaningful res when running in /data/hpi??

my/core/init.py:40: UserWarning: 'my.config' package isn't found! (expected at /home/karlicos/.config/my). This is likely to result in issues.
See https://github.com/karlicoss/HPI/blob/master/doc/SETUP.org#setting-up-the-modules for more info.
  """.strip())
✅ config file: my/config/__init__.py
❌ mypy check: failed
   Can't find package 'my.config'

`[2019-12-24]` inspiration: hugginn credentials inspiration:

http://localhost:3000/user_credentials

Your Credentials
Credentials are used to store values used by many Agents. Examples might include "twitter_consumer_secret", "user_full_name", or "user_birthday".

that's quite nice; would be cool to display credentials for my kron thing?

doc: Hmm i wonder if egg links can be used on systems without symlinks? [[pip]] [[python]]

* patterns for writing concise and safe modules

design: dateclasses – mutable vs immutable [[hpi]]

generally prefer mutable? errors would be rare, no one expects modifying data to do anything meaningful – and if they do, they really want it?
better to make immutable via Final (so it's possible to check statically, but have an escape hatch if necessary)

check for dataframe 'error' column [[errors]] [[pandas]]

functions with default inputs= argument

better not to use it:

causes early inputs() calls
propagating all the way down wrappers (dataframes/aggregate functions etc) is unrealistic anyway
easy to override inputs() in tests, etc, sort of 'dependncy injection'

downsides:

unclear how to cachew()???
although could just have lazy inputs() key. not that bad.

keep date as the first attribute to make sorting easier

Could use properties for lazier paths

top level decorator to check that some data was emitted?

that could help for configuration mistakes

maybe have sensible fallbacks for configs? e.g. falling back to documents folder, builtin python packages/site dire/etc

use venv instead of repos symlinks [[hpi]]

Could use protocols (with Literal types) for pandas dfs??? [[pandas]] [[mypy]]

pattern: avoid importing config early so modules can work without it? [[hpi]]

Add an example, maybe with dynamic my.config module

hmm. could just use ripgreppy parsing for processing htmls?? [[promnesia]]

`[2020-05-16]` Lazy — MacroPy3 1.1.0 documentation [[python]]

hmmm… nice
maybe could try it dith defensive behaviour…

avoid fromtimestamp? [[python]]

`[2020-05-03]` reddit: zstd vs lz4 comparison [[reddit]] [[exports]] [[hpi]]

about 3803 files

  du -ch *.xz | tail -n 1
2.1G	total
  du -ch *.zstd | tail -n1
2.9G	total

`[2020-05-03]` comparison of zstd vs lz4 [[reddit]] [[hpi]]

(every tenth file, cache disabled)

lz4 : ./test  31.20s user 2.58s system 101% cpu 33.285 total
zstd: ./test  21.37s user 2.52s system 103% cpu 23.007 total

I mean, 1.5x is kinda nice…

wonder if can make Ipython force the iterators? [[python]]

`[2021-03-15]` config: extending base config which has Paths/Pathish and List as the default attribute [[hpi]]

e.g. in mycfg

class commits:
   roots: Sequence[PathIsh] = [L]

in my.commits

@dataclass
class commits_cfg(user_config):
    roots: Sequence[PathIsh] # --- this complains    ValueError: mutable default <class 'list'> for field roots is not allowed: use default_factory. shit
    emails: Optional[Sequence[str]] = None
    names: Optional[Sequence[str]] = None

huh, so adding roots equals field(default_factory=list) solved it?…

handles archived stuff via CPath helper [[hpi]]

requires a bit of cooperation by using isinstance check in DAL? … maybe inputs should take str, dunno

* data providers/sources

the fuck??? after about 16019960000803 the timestamps for individual measurements basically stopped updating?? [[hpi]] [[bluemaestro]]

wtf?????

rescuetime: figure out utc or not

podcast addict

has 'playbackDate' in episodes table
seems that only podcastAddict.db is useful, the rest is just crap

gpslogger?

`[2019-09-17]` jlumpe/pyorg: Python library for working with Emacs org mode. [[org]]

>>> org.orgdir  # Obtained automatically from org-directory variable in Emacs
OrgDir('/home/jlumpe/org/')

huh that's quite mad!

define reasonable ranges for exercises so I could detect errors.. [[wledger]]

`[2020-10-05]` seanbreckenridge/ipgeocache: A small cache layer for IP geolocation info

commits – need to cachew? [[cachew]]

reddit: maybe get rid of 'unfavorited'?… [[reddit]]

`[2020-05-21]` `ping/instagram_private_api`: A Python library to access Instagram's private API.

some ijson warnings [[location]]

tests/takeout.py::test_location_perf
  /home/karlicos/.local/lib/python3.7/site-packages/ijson/compat.py:47: DeprecationWarning:
  ijson works by reading bytes, but a string reader has been given instead. This
  probably, but not necessarily, means a file-like object has been opened in text
  mode ('t') rather than binary mode ('b').
    warnings.warn(_str_vs_bytes_warning, DeprecationWarning)

Hmm maybe filter reddit and only include every 10th or something to speed it up? [[hpi_patterns]] [[reddit]]

check frequencies?? [[bluemaestro]]

timezone provider issues [[location]]

huh, that's random

datetime.datetime(2012, 5, 8, 17, 37, 28, 181000, tzinfo=<DstTzInfo 'Europe/Moscow' MSK+4:00:00 STD>),
  'Europe/Moscow'),
 (datetime.datetime(2012, 5, 8, 20, 46, 27, 16000, tzinfo=<DstTzInfo 'Asia/Novosibirsk' +07+7:00:00 STD>),
  'Asia/Novosibirsk'),
 (datetime.datetime(2012, 5, 8, 20, 50, 3, 274000, tzinfo=<DstTzInfo 'Asia/Novosibirsk' +07+7:00:00 STD>),
  'Asia/Novosibirsk'),

twitter archive trims the retweets (TODO put in the documentation?) [[twitter]]

`[2020-10-15]` wger/exercises.json at c70150b4850f2c7ab2fdc7a953c3c11f84d31e8c · wger-project/wger [[exercise]]

"creation_date": null,
 "category": 12,
 "uuid": "7ce6b090-5099-4cd0-83ae-1a02725c868b",
 "muscles": [
     12
 ],
 "license": 1,
 "name": "Pull-ups"

ok, nice it already has muscles involved.. I could use this data

stackexchange gdpr has ip addresses

location provider: foursquare/swarm

twint doesn't get retweets [[twint]] [[twitter]]

https://github.com/twintproject/twint/issues/786

twint -u karlicoss --retweets

need to switch all formats to json.. I guess it's still reasonable to have HTML parser because old takeouts didn't have it [[takeout]]

`[2021-02-04]` seanbreckenridge/discord_data: Library to parse messages/activity from the discord data export [[discord]] [[hpi]]

when searching for commits, make sure archived repos are present

`[2021-02-27]` Upvoted submissions | Hacker News [[hackernews]] [[orger]] [[hpi]]

`[2020-10-14]` HPI/skype.py at 4a0eb2d8e3ae963e315f0eaa7f538b46ef5513f5 · seanbreckenridge/HPI

attempt to reverse geocache photos

ugh. most libraries are outdated…
https://github.com/thampiman/reverse-geocoder
some hackery…

import geopy
from geopy.geocoders import Nominatim
from geopy.extra.rate_limiter import RateLimiter
locator = Nominatim(user_agent="myGeocoder")
# getloc = RateLimiter(locator.reverse, min_delay_seconds=0.001)
#
from functools import lru_cache

@lru_cache(None)
def query(p):
    print("UNCACHED!! ", p)
    return locator.reverse(p)

def getloc(p):
    lat, lon = p
    lat = round(lat, ndigits=3)
    lon = round(lon, ndigits=3)
    return query((lat, lon))

old last.fm + spotify + bandcamp arbitration

switch pinboard to HPI [[promnesia]]

hmm, keeping history of when I followed people on twitter could be useful.. [[promnesia]] [[hpi]]

how to make sure all providers are handled? [[taplog]] [[hpi]]

allow timestamp for likes? just make it optional and use in orger if possible [[twitter]] [[hpi]]

pdfs: would be interesting to filter by author? dunno it's often not set/empty… [[hpi]]

pdfs: maybe extract some meta to build index? [[hpi]]

`[2021-04-05]` piyueh/zoteroutils: Python API to interact with Zotero's local SQLite database. [[zotero]] [[HPI]]

inactive windows are sort of useful too hmm [[hpi]] [[arbtt]]

cache pdfs by file? [[hpi]] [[cachew]]

* improving testing & CI

also see J. Doe., a project aiming to create an artificial person/data narrative

could test against twitter database

actually could even commit it to github…
use some really really public account?

perhaps, 'fake data' generators belong to DAL/HPI as well? that way easy to keep in sync [[jdoe]]

sigh.. mimesis can't generate dates between two other, but works with json 'schemas' [[jdoe]]

faker can do that but doesn't support schemas out of the box..

mimesis: can't do gauss

use similar sample data download to bokeh? could be good for testing etc. [[dashboard]] [[project]]

* publicity & reaching out to other people

describe what I've done by the commit history? and comments etc [[toblog]]

one of the goals is demonstraing the architecture [[toblog]]

I appreciate not everyone uses the same data as I do.
My point is showing that my private layer is actually pretty thin and you can implement something TODO suiting you by looking at mine as an example.

Same way as TODO think of some analogy? when you're using a todo list app, you've got your own unique pattern. Yet, we all benefit massively from sharing the same infrastructure

planetpython etc? [[publish]]

`[2021-02-15]` (6) InfluxData (@InfluxDB) / Twitter [[hpi]] [[publish]]

could tweet at them/grafana?

about endomondo shutting down and using runnerup for workouts, show the commits [[hpi]] [[tweet]] [[outbox]]

publish the thing about HPI configs? [[hpi]] [[toblog]]

tweet about hpi + photos integration [[hpi]] [[totweet]] [[outbox]]

have a screenshot

datasette .cache/my.photos.main:_photos  --config max_returned_rows:20000

can bookmark the query, so it's basically stateless
stretch the map height
need to add JS with file links (and possibly thumbnails? not sure if it's gonna work well)

* enhancements

get rid of individual cache paths? there is no point in them really… [[cachew]]

rename mcachew to cachew?? so it's less confusing [[cachew]]

for stats frequency (e.g. bluemaestro), also need to calculate 'reverse frequency'? e.g. how many 1 minute intervals are covered

async interface (possibly async wrapper for the whole modules?) os it emits iterator of dataframes, and when thedata updated, new df is emitted

use it in github provider after I support exceptions [[cachew]]

think about overlaying user config on top of default dynamically? not sure…

`[2020-04-11]` stephen-bunn/file-config: Attrs-like file config definitions inspired from https://github.com/hynek/environ_config [[configs]]

https://github.com/stephen-bunn/file-config

treat deleted pinboard items as deleted/archived; expliclitly [[hpi]] [[pinboard]]

maybe need some nicer algorithm, to prevent flickering (maybe it doesn't happen anymore though)

need to add hooks to config that get executed when HPI is imported? so people could hack without changing apps' code

in v2.0, get rid of old my.config artifacts

`[2019-12-12]` Re: [Scarygami/location-history-json-converter] Streaming parsing (#16) [[location]]

o Scarygami/location-history-json-converter, me, Author
Streaming parsing (--iterative) is now possible.
The functionality requires ijson to be installed.

ok, pipenv seems like a pleasant way of experimenting, maybe give it a shot

see https://stackoverflow.com/questions/41573587/what-is-the-difference-between-venv-pyvenv-pyenv-virtualenv-virtualenvwrappe

maybe have a special tag, e.g. nohpi to shadow entries from hpi? although sometimes nice to retrieve all entries (but basically only one usecase for that, timeline) [[org]] [[hpi]]

`[2019-12-30]` esnme/ultrajson: Ultra fast JSON decoder and encoder written in C with Python bindings

make it optional dependency with fallback?

`[2020-05-15]` Type alias as a class member is not valid as a type · Issue #7866 · python/mypy [[mypy]] [[hpi]]

Alias = NamedTuple("Alias", [("field", str)])

hmm, alias could be used as 'Like' type? for make_config

`[2020-05-12]` HPI/CONFIGURING.org at master · karlicoss/HPI defensive Protocol stub?

so using it requires guarding the code with if typing.TYPE_CHECKING, which is a bit confusing and bloating.

could have a defensive import in my.core.typing

`[2019-12-24]` inspiration: credentials dashboard? Huginn [[hpi]]

Your Credentials
    Credentials are used to store values used by many Agents. Examples might include "twitter_consumer_secret", "user_full_name", or "user_birthday".

'hpi shell' command launches python shell

configuration [[hpi]]

from my.config import core as user_config # type: ignore[attr-defined]

maybe instead of defining dynamic bits, import stuff from my.module.config? and then override? not sure

entity guessing: in materialistic module, make sure hpi stat my.materialistic returns last entity time [[hpi]]

automatic ids

`[2021-04-04]` Shell Completion — Click Documentation (7.x) [[hpi]]

* bugs/issues

github issues

windows compatibility.. [[hpi]]

hpi doctor fails with some inf recursion??
my.location.takeout module is mentioned but unavailable??

hmm, iterator in `iter_tzs` never exhausts? cause it doesn't go over the last year. so it won't cache things??

and then, location caching also never properly happens. uhoh

MY_CONFIG should resolve path to absolute?

tzabbr hack attempt

for zone in pytz.all_timezones:
    tz = pytz.timezone(zone)
    infos = getattr(tz, '_tzinfos', [])
    for _, _, x in infos:
        tz_lookup[x] = tz

doctor: for compileall check need to use tmp path? [[hpi]]

✅ config file : /.config/my/my/config/__init__.py
Compiling '/.config/my/my/config/__init__.py'...
*** OSError: [Errno 30] Read-only file system: '/.config/my/my/config/__pycache__'

hmm stats look a bit off? [[hpi]]

✅ OK  : my.reading.goodreads
✅     - stats: {'books': {'books': {'count': 222, 'last': datetime.datetime(2013, 7, 14, 2, 58, 4, tzinfo=datetime.timezone(datetime.timedelta(days=-1, seconds=61200)))}}, 'events': {'events': {'count': 222, 'last': datetime.datetime(2013, 7, 14, 2, 58, 4, tzinfo=datetime.timezone(datetime.timedelta(days=-1, seconds=61200)))}}, 'inputs': {'inputs': {'count': 934}}, 'reviews': {'reviews': {'count': 222}}}

this is when forget parens after @cachew [[hpi]]

 ❯ python3 xx.py
Traceback (most recent call last)
  File "xx.py", line 6, in <module>
    for x in M.bookmarks():
TypeError: <lambda>() missing 1 required positional argument: 'realf'

* misc

Uncategorized stuff

integrate with private overlay

need to test behaviour w.r.t order of running local install?

Automatic sqlite interface.. People seem to like it? [[cachew]]

`[2020-12-07]` CLI Guidelines – A guide to help you write better command-line programs | Hacker News

if you are displaying tabular data, present an ncurses interface

feed into visidata?

`[2020-11-14]` Personal Data Warehouses: Reclaiming Your Data | Hacker News

I believe all data warehouses are limited by the quality of their data model. Most start with good relational intentions over a small domain, but eventually get bogged down arguing how semantic angels might dance on ontological pins. The parts that work become ossified and impossible to change. The system starts to fragment into multiple federated datastores or unstructured file dumps (“big data!”) where you have to build your own integration every time you want to use the data. Someone comes along and proposes a unifying model (“everything is an event!”) and rebuilds the whole thing but with an extra layer of complexity. Someone suggests buying an industry data model instead - surely the data experts will have solved all these problems for us? A skunkworks project spins up and starts implementing the bought model with good relational intentions over a small domain...
I don’t think personal data warehouses are immune to any of these forces.

github traffic dashboard for each repo? [[hpi]] [[toblog]]

`[2020-12-07]` Leah Neukirchen (@LeahNeukirchen): "I put my IRC logs of the last decade into that, here is a dot for all 489398 lines I wrote:" | nitter [[viz]]

https://twitter.com/LeahNeukirchen/status/1335669406588923905

I put my IRC logs of the last decade into that, here is a dot for all 489398 lines I wrote:

could write a tool to process historic stats for github referrers etc? [[toblog]] [[coding]]

`[2021-02-23]` Yet another Тарантога [[hpi]]

`[2020-10-05]` mention data gathering libraries · seanbreckenridge/HPI@fbe4ffc

Disregarding tools which actively collect data (like [`ttt`](https://github.com/seanbreckenridge/ttt)/[`window_watcher`](https://github.com/seanbreckenridge/aw-watcher-window)), I have some other libraries I've created for this project, to provide more context to some of the data.
- [`ipgeocache`](https://github.com/seanbreckenridge/ipgeocache) - for any IPs gathered from data exports, provides geolocation info, so I have location info going back to 2013 (thanks facebook)

`[2020-10-19]` Blog/ddde0c1c-8f73-47ff-803a-342f85a5fa72.md at 45f5922e999cc1ad8dba74f695d3762bed3624f6 · dentropy/Blog

What features would I want in my HPI?

`[2020-09-19]` iterable -> iterator · seanbreckenridge/HPI@90a16bb

wonder why did he do that?
Iterable needs to be iter(), e.g. you can't return list as Iterator

Slots vs dataclasses [[python]] [[mypy]]

Good writeup. A couple points.
`zope.interface` is more explicit and scalable than `typing.Protocol`s, and more flexible than `abc.ABC`. There's a mypy plugin for it: https://github.com/Shoobx/mypy-zope
> The drawback is that code that changes the representation of its data a lot tends not to be fast code.
That's not a very convincing reason to avoid dataclasses except in the most performance-constrained environments -- and even then I'm doubtful it'd help. Especially with `slots=True`, dataclasses can take less resources.

`[2020-01-01]` John Stultz on Twitter: "random idea: Want something that I can point it at various services (imap/rss/other web services like gphotos,twitter) or takeout archives and it will import/dedup/index/archive locally on my system." / Twitter https://twitter.com/johnstultz_work/status/1156691692772196352 [[hpi]] [[webarchive]]

John Stultz
@johnstultz_work
random idea: Want something that I can point it at various services (imap/rss/other web services like gphotos,twitter) or takeout archives and it will import/dedup/index/archive locally on my system.

`[2020-05-16]` User awal | Lobsters

Anyway, thanks a lot for building all this stuff. Definitely gonna explore and it also helped me refine some of my thoughts on the subject!

`[2020-05-02]` hyfen.net/memex/updates/putting-the-memex-into-a-container-shazam-other-memex-sightings

My main objective right now is packaging what I’m working on into something that I can easily get to beta testers.

`[2021-03-09]` tried using monkeypatch to infer output types.. [[types]] [[hpi]]

tried with my.pinboard module for bookmarks() function:

can infer List[Bookmark]
can infer List[Union[Bookmark, RuntimeError]]
doesn't seems to be able to infer yield… pretty annoying

so all in all seems that it would be easier to assume Res[X] and try to guess X?

"data repository" is a good description? [[hpi]]

shit Url alias doesn't work… [[hpi]]

Url = NewType('Url', str)

what's up with this Bookmark thing??

[ins] In [24]: inspect.signature(Bookmark.url.fget)
Out[24]: <Signature (self) -> <function NewType.<locals>.new_type at 0x7f9c8626ce50>>

`[2021-03-07]` Hypothesis [[hpi]]

update hypothesis link?

`[2021-03-08]` Instagram/MonkeyType: A system for Python that generates static type annotations by collecting runtime types [[hpi]] [[cachew]]

MonkeyType collects runtime types of function arguments and return values, and can automatically generate stub files or even add draft type annotations directly to your Python code based on the types collected at runtime.

could use for some magic caching/inference of serialization? not sure

`[2021-04-12]` Extract, transform, load - Wikipedia [[hpi]]

I guess it's kind of 'auto'? Although ETL sounds a bit magical

`[2021-03-13]` qs_ledger/instapaper_{downloader.ipynb} at master · markwk/qs_ledger [[hpi]]

see what's their approach to credentials

--

classify modules by ease of setup? [[hpi]]

I'm not inventing anything new – trying to apply simplicity, decomposition and resilience principles [[hpi]]

ids are useful to mark some stuff as public (e.g. annotations) [[hpi]] [[memex]]

could implement some helper that prompts visidata for column types [[visidata]] [[hpi]]

⥅ node [[hr]] pulled by Agora

📓 garden/flancian/Library/Core/Snippet/hr.md by @flancian

⥅ node [[i3]] pulled by Agora

📓 garden/flancian/i3.md by @flancian

I3

My [[window manager]] of choice.
By [[Michael Stapelberg]].

⥅ node [[ict]] pulled by Agora

📓 garden/neil/ict.md by @neil

ICT

⥅ node [[iem]] pulled by Agora

📓 garden/flancian/iem.md by @flancian

[[pull]] [[instrumental electronic music]]

⥅ node [[ii]] pulled by Agora

📓 garden/flancian/ii.md by @flancian

Ii

⥅ node [[iii]] pulled by Agora

📓 garden/flancian/iii.md by @flancian

Iii

[[pull]] [[innovation information initiative]]

⥅ node [[ios]] pulled by Agora

📓 garden/flancian/ios.md by @flancian

ios

⥅ node [[iou]] pulled by Agora

📓 garden/KGBicheno/Artificial Intelligence/Introduction to AI/Week 3 - Introduction/Definitions/Iou.md by @KGBicheno

IoU

Go back to the [[AI Glossary]]

Abbreviation for intersection over union.

⥅ node [[irc]] pulled by Agora

📓 garden/flancian/irc.md by @flancian

Irc

Invented by [[jarkko oikarinen]].
A simple protocol at heart, yet extensible enough to be still going strong more than 30 years later.
My first taste of the "internet" (not really) came when I connected to a free account that an ISP in [[Argentina]] offered through a local number. With the free account you could only access a single website (the ISP's), and an IRC server. The IRC server had a tight community of people from around the country that were doing the same thing I was.
- [[satlink]].

📓 garden/neil/irc.md by @neil

IRC

Use this mainly just for indieweb chat at the moment.

⥅ node [[ivo]] pulled by Agora

📓 garden/flancian/ivo.md by @flancian

a [[person]].
- [[editor]].
- #pull [[kvistgaard]] [[ivo velitchkov]]

⥅ node [[iww]] pulled by Agora

📓 garden/neil/iww.md by @neil

IWW

📓 stoa/doc.anagora.org/iww.md by @anonymous@doc.anagora.org

<title>500 Internal Error wtf.

<link rel="stylesheet" href="https://doc.anagora.org/css/center.css">

New
Publish
Extra
Revision
Slide Mode

            <li class="divider"></li>
            <li class="dropdown-header">Export</li>
            <li role="presentation"><a role="menuitem" class="ui-save-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
            </li>
            
            <li role="presentation"><a role="menuitem" class="ui-save-gist" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-github fa-fw"></i> Gist</a>
            </li>
            
            
            
            <li class="divider"></li>
            <li class="dropdown-header">Import</li>
            <li role="presentation"><a role="menuitem" class="ui-import-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-import-gist" href="#" data-toggle="modal" data-target="#gistImportModal"><i class="fa fa-github fa-fw"></i> Gist</a>
            </li>
            
            <li role="presentation"><a role="menuitem" class="ui-import-clipboard" href="#" data-toggle="modal" data-target="#clipboardModal"><i class="fa fa-clipboard fa-fw"></i> Clipboard</a>
            </li>
            <li class="divider"></li>
            <li class="dropdown-header">Download</li>
            <li role="presentation"><a role="menuitem" class="ui-download-markdown" tabindex="-1" href="#" target="_self"><i class="fa fa-file-text fa-fw"></i> Markdown</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-download-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> HTML</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-download-raw-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> Raw HTML</a>
            </li>
            <li class="divider"></li>
            <li role="presentation"><a role="menuitem" class="ui-help" href="#" data-toggle="modal" data-target=".help-modal"><i class="fa fa-question-circle fa-fw"></i> Help</a>
            </li>
        </ul>
        <a class="btn btn-link ui-mode">
            <i class="fa fa-pencil"></i>
        </a>
    </div>
</div>
<div class="collapse navbar-collapse">
    <ul class="nav navbar-nav navbar-form navbar-left" style="padding:0;">
        <div class="btn-group" data-toggle="buttons">
            <label class="btn btn-default ui-view" title="View (Ctrl+Alt+V)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-eye"></i>
            </label>
            <label class="btn btn-default ui-both" title="Both (Ctrl+Alt+B)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-columns"></i>
            </label>
            <label class="btn btn-default ui-edit" title="Edit (Ctrl+Alt+E)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-pencil"></i>
            </label>
        </div>
        <div class="btn-group" data-toggle="buttons">
            <label class="btn ui-night" title="Night Theme">
                <input type="checkbox" name="night"><i class="fa fa-moon-o"></i>
            </label>
        </div>
        <span class="btn btn-link btn-file ui-help" title="Help" data-toggle="modal" data-target=".help-modal">
            <i class="fa fa-question-circle"></i>
        </span>
    </ul>
    <ul class="nav navbar-nav navbar-right">
        <li id="online-user-list">
            <a class="ui-status" data-toggle="dropdown">
                <span class="label label-danger"><i class="fa fa-plug"></i> OFFLINE</span>
            </a>
            <ul class="dropdown-menu list" role="menu" aria-labelledby="menu" style="right: 15px;width: 200px;">
            </ul>
        </li>
    </ul>
    <ul class="nav navbar-nav navbar-right" style="padding:0;">
        <li>
            <a href="https://doc.anagora.org/new" target="_blank" rel="noopener" class="ui-new">
                <i class="fa fa-plus"></i> New
            </a>
        </li>
        <li>
            <a href="#" target="_blank" rel="noopener" class="ui-publish">
                <i class="fa fa-share-square-o"></i> Publish
            </a>
        </li>
        <li>
            <a data-toggle="dropdown">
                Menu <i class="fa fa-caret-down"></i>
            </a>
            <ul class="dropdown-menu list" role="menu" aria-labelledby="menu">
                <li class="dropdown-header">Extra</li>
                <li role="presentation"><a role="menuitem" class="ui-extra-revision" tabindex="-1" data-toggle="modal" data-target="#revisionModal"><i class="fa fa-history fa-fw"></i> Revision</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-extra-slide" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-tv fa-fw"></i> Slide Mode</a>
                </li>
                
                <li class="divider"></li>
                <li class="dropdown-header">Export</li>
                <li role="presentation"><a role="menuitem" class="ui-save-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
                </li>
                
                <li role="presentation"><a role="menuitem" class="ui-save-gist" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-github fa-fw"></i> Gist</a>
                </li>
                
                
                
                <li class="divider"></li>
                <li class="dropdown-header">Import</li>
                <li role="presentation"><a role="menuitem" class="ui-import-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-import-gist" href="#" data-toggle="modal" data-target="#gistImportModal"><i class="fa fa-github fa-fw"></i> Gist</a>
                </li>
                
                <li role="presentation"><a role="menuitem" class="ui-import-clipboard" href="#" data-toggle="modal" data-target="#clipboardModal"><i class="fa fa-clipboard fa-fw"></i> Clipboard</a>
                </li>
                <li class="divider"></li>
                <li class="dropdown-header">Download</li>
                <li role="presentation"><a role="menuitem" class="ui-download-markdown" tabindex="-1" href="#" target="_self"><i class="fa fa-file-text fa-fw"></i> Markdown</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-download-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> HTML</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-download-raw-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> Raw HTML</a>
                </li>
            </ul>
        </li>
    </ul>
</div>

<div class="container-fluid text-center">
    <div class="vertical-center-row">
        <h1>500 Internal Error <small>wtf.</small></h1>
    </div>
</div>

⥅ node [[jab]] pulled by Agora

📓 garden/flancian/jab.md by @flancian

[[pull]] [[jab code]]

⥅ node [[jam]] pulled by Agora

📓 garden/bmann/_notes/jam.md by @bmann

"Jam is an audio space for chatting, brainstorming, debating, jamming, micro-conferences and more."

Open source under the [[AGPL License]], mostly written in [[JavaScript]].

From the README:

Jam is an Open Source alternative to Clubhouse, Twitter Spaces and similar audio spaces. With Jam you can create Jams which are audio rooms that can be used for panel discussions, jam sessions, free flowing conversations, debates, theatre plays, musicals and more. The only limit is your imagination.

It uses [[Docker]] and is made up of a [[React]] front end, mafintosh/signalhub for managing [[WebRTC]] connections, and a [[NodeJS]] server pantry "lightweight server for handling authentication and coordination of Jam"

⥅ node [[job]] pulled by Agora

📓 garden/flancian/job.md by @flancian

Job

What you do for a living.

⥅ node [[jwz]] pulled by Agora

📓 garden/flancian/jwz.md by @flancian

JWZ

I know him from long ago -- but he doesn't know me.

⥅ node [[jz]] pulled by Agora

📓 garden/flancian/jz.md by @flancian

a [[person]].
- [[friend]]
- She helped me while I was going through my breakup and I'm grateful.
- I think of her often.
- I love her.

📓 stoa/doc.anagora.org/jz.md by @anonymous@doc.anagora.org

<title>500 Internal Error wtf.

<link rel="stylesheet" href="https://doc.anagora.org/css/center.css">

New
Publish
Extra
Revision
Slide Mode

            <li class="divider"></li>
            <li class="dropdown-header">Export</li>
            <li role="presentation"><a role="menuitem" class="ui-save-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
            </li>
            
            <li role="presentation"><a role="menuitem" class="ui-save-gist" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-github fa-fw"></i> Gist</a>
            </li>
            
            
            
            <li class="divider"></li>
            <li class="dropdown-header">Import</li>
            <li role="presentation"><a role="menuitem" class="ui-import-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-import-gist" href="#" data-toggle="modal" data-target="#gistImportModal"><i class="fa fa-github fa-fw"></i> Gist</a>
            </li>
            
            <li role="presentation"><a role="menuitem" class="ui-import-clipboard" href="#" data-toggle="modal" data-target="#clipboardModal"><i class="fa fa-clipboard fa-fw"></i> Clipboard</a>
            </li>
            <li class="divider"></li>
            <li class="dropdown-header">Download</li>
            <li role="presentation"><a role="menuitem" class="ui-download-markdown" tabindex="-1" href="#" target="_self"><i class="fa fa-file-text fa-fw"></i> Markdown</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-download-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> HTML</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-download-raw-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> Raw HTML</a>
            </li>
            <li class="divider"></li>
            <li role="presentation"><a role="menuitem" class="ui-help" href="#" data-toggle="modal" data-target=".help-modal"><i class="fa fa-question-circle fa-fw"></i> Help</a>
            </li>
        </ul>
        <a class="btn btn-link ui-mode">
            <i class="fa fa-pencil"></i>
        </a>
    </div>
</div>
<div class="collapse navbar-collapse">
    <ul class="nav navbar-nav navbar-form navbar-left" style="padding:0;">
        <div class="btn-group" data-toggle="buttons">
            <label class="btn btn-default ui-view" title="View (Ctrl+Alt+V)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-eye"></i>
            </label>
            <label class="btn btn-default ui-both" title="Both (Ctrl+Alt+B)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-columns"></i>
            </label>
            <label class="btn btn-default ui-edit" title="Edit (Ctrl+Alt+E)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-pencil"></i>
            </label>
        </div>
        <div class="btn-group" data-toggle="buttons">
            <label class="btn ui-night" title="Night Theme">
                <input type="checkbox" name="night"><i class="fa fa-moon-o"></i>
            </label>
        </div>
        <span class="btn btn-link btn-file ui-help" title="Help" data-toggle="modal" data-target=".help-modal">
            <i class="fa fa-question-circle"></i>
        </span>
    </ul>
    <ul class="nav navbar-nav navbar-right">
        <li id="online-user-list">
            <a class="ui-status" data-toggle="dropdown">
                <span class="label label-danger"><i class="fa fa-plug"></i> OFFLINE</span>
            </a>
            <ul class="dropdown-menu list" role="menu" aria-labelledby="menu" style="right: 15px;width: 200px;">
            </ul>
        </li>
    </ul>
    <ul class="nav navbar-nav navbar-right" style="padding:0;">
        <li>
            <a href="https://doc.anagora.org/new" target="_blank" rel="noopener" class="ui-new">
                <i class="fa fa-plus"></i> New
            </a>
        </li>
        <li>
            <a href="#" target="_blank" rel="noopener" class="ui-publish">
                <i class="fa fa-share-square-o"></i> Publish
            </a>
        </li>
        <li>
            <a data-toggle="dropdown">
                Menu <i class="fa fa-caret-down"></i>
            </a>
            <ul class="dropdown-menu list" role="menu" aria-labelledby="menu">
                <li class="dropdown-header">Extra</li>
                <li role="presentation"><a role="menuitem" class="ui-extra-revision" tabindex="-1" data-toggle="modal" data-target="#revisionModal"><i class="fa fa-history fa-fw"></i> Revision</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-extra-slide" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-tv fa-fw"></i> Slide Mode</a>
                </li>
                
                <li class="divider"></li>
                <li class="dropdown-header">Export</li>
                <li role="presentation"><a role="menuitem" class="ui-save-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
                </li>
                
                <li role="presentation"><a role="menuitem" class="ui-save-gist" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-github fa-fw"></i> Gist</a>
                </li>
                
                
                
                <li class="divider"></li>
                <li class="dropdown-header">Import</li>
                <li role="presentation"><a role="menuitem" class="ui-import-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-import-gist" href="#" data-toggle="modal" data-target="#gistImportModal"><i class="fa fa-github fa-fw"></i> Gist</a>
                </li>
                
                <li role="presentation"><a role="menuitem" class="ui-import-clipboard" href="#" data-toggle="modal" data-target="#clipboardModal"><i class="fa fa-clipboard fa-fw"></i> Clipboard</a>
                </li>
                <li class="divider"></li>
                <li class="dropdown-header">Download</li>
                <li role="presentation"><a role="menuitem" class="ui-download-markdown" tabindex="-1" href="#" target="_self"><i class="fa fa-file-text fa-fw"></i> Markdown</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-download-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> HTML</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-download-raw-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> Raw HTML</a>
                </li>
            </ul>
        </li>
    </ul>
</div>

<div class="container-fluid text-center">
    <div class="vertical-center-row">
        <h1>500 Internal Error <small>wtf.</small></h1>
    </div>
</div>

⥅ node [[k9]] pulled by Agora

📓 garden/neil/k9.md by @neil

K9

Many formerly squatted-in buildings emerged into collective ownership and some, like K9, where one of [[Freifunk]]’s founders lived, embraced radical principles of common governance. These principles included economic agreements limiting rents to the costs of maintenance and social agreements specifying collective decision-making supported by monthly meetings.

– [[Undoing Optimization: Civic Action in Smart Cities]]

These buildings could have dozens of apartments, and at K9, apartments were inhabited in rotation so that all building residents would have an equal chance to live in the larger or more beautiful spaces.

– [[Undoing Optimization: Civic Action in Smart Cities]]

This principle of fairness and justice resulted in a moving day every three years, when groups of apartment mates reconfigured as everyone moved house.

– [[Undoing Optimization: Civic Action in Smart Cities]]

⥅ node [[ket]] pulled by Agora

📓 garden/s5bug/ket.md by @s5bug

Ket

$\ket{u}$ where $u$ is the name of a state
[[push]] [[column-vector]]

⥅ node [[ki]] pulled by Agora

📓 garden/evan/Ki.md by @evan

⥅ node [[km]] pulled by Agora

📓 garden/flancian/km.md by @flancian

a [[person]].
- A lovely one :)
- #go https://docs.google.com/document/d/1-3s0hosefnLMpwTKTBnqaeFtwnCAAtxXlCpawXLuXq4/edit?tab=t.0
- Thank you for being here!

⥅ node [[koa]] pulled by Agora

📓 garden/flancian/koa.md by @flancian

koa

a [[framework]]
- [[web]] [[node js]]
- [[go]] https://koajs.com

⥅ node [[l-]] pulled by Agora

📓 garden/flancian/l..md by @flancian

L.

Purslane/portulacas.
[[a positive]] [[blood]]
I think I'm [[b negative]]? But when I was younger I thought I was [[0 negative]].

⥅ node [[l-a]] pulled by Agora

📓 garden/flancian/l. a.md by @flancian

a [[person]].
- [[philosopher]]
- #go https://lapaul.org/

⥅ node [[lag]] pulled by Agora

📓 garden/flancian/lag.md by @flancian

Lag

A [[short story]].

I lag all the time. I keep wondering about it.

⥅ node [[law]] pulled by Agora

📓 garden/law/law.md by @law

Law

The law consists of all the rules enforceable by a governmental authority. These are commonly divided into [[civil law]] and [[criminal law]]. Whereas the civil law is only enforceable against property, criminal law may also be enforced against the person (both arrest and imprisonment).

At times the lines between the two are blured. For example, certain criminal law violations will never lead to either arrest nor imprisonment. And the remedy for certain civil law violations may be an injunction, which can mandate or prohibit certain behavior. The violation of such an injunction may include criminal penalties or criminal-like penalties (such as imprisonment).

@law primarily covers U.S. law, but tries to generalize where possible.

⥅ node [[lex]] pulled by Agora

📓 garden/flancian/Lex.md by @flancian

a [[person]].
- He doesn't know me (yet?) but I feel like I know him -- when I write [[Lex]] I usually mean [[Lex Fridman]].
- So our friendship started [[parasocial]] but part of me feels is quite established, just based on his views and intentions as I understand them :)
- [[Open Letter to Lex]]

⥅ node [[lip]] pulled by Agora

📓 garden/evan/Lip.md by @evan

Hello, this correspondence is coming to you in light of our recent discussion on polarizing the petty. I have had some recent equations in this accord I would like to share, if I may be so bold. Skimpily, if we offset the lonely compound through use of alex I believe we could negate the future lunch. It's probably worth a try, if you have a moment.

⥅ node [[llm]] pulled by Agora

📓 garden/flancian/LLM.md by @flancian

a [[tool]].
- CLI to interface with a variety of [[LLMs]].
- by [[Simon Willison]].
- I set it up on [[2024-03-02]] and added API keys for:
  - [[openai]]
  - [[mistral]]
  - [[google]] ([[gemini]]) -- this was the hardest, needlessly IMHO.

📓 garden/neil/llm.md by @neil

LLM

⥅ node [[log]] pulled by Agora

📓 garden/karlicoss/books/log.md by @karlicoss

[[https://www.blinkist.com/en/books/moonwalking-with-einstein-en]] [[memory]]
[2018-06-15] Inadequate Equilibria: Where and How Civilizations Get Stuck
[2018-01-03] айзек азимов движущая сила
[2018-01-02] Лем Загадка [[mds]]
[2019-02-13] BLIT - a short story by David Langford http://www.infinityplus.co.uk/stories/blit.htm [[mind]] [[godel]]
[2019-04-08] Шекли прогулка [[mds]] [[book]]

https://www.blinkist.com/en/books/moonwalking-with-einstein-en [[memory]]

phonological loop
So the next time you need to learn a new name, make an association between the sound of the person’s name and a vivid image. For instance, Ronald Reagan could become Donald Duck (Donald sounds like Ronald) holding a Ray Gun (Reagan).

`[2018-06-15]` Inadequate Equilibria: Where and How Civilizations Get Stuck

https://www.scottaaronson.com/blog/?p=3535

`[2018-01-03]` айзек азимов движущая сила

meh, not too interesting
about Earth ecological control and guy who wanted biodiversity

`[2018-01-02]` Лем Загадка [[mds]]

Quite primitive, no punchline. Robot names & stuff is a bit corny.

`[2019-02-13]` BLIT - a short story by David Langford http://www.infinityplus.co.uk/stories/blit.htm [[mind]] [[godel]]

`[2019-04-08]` Шекли прогулка [[mds]] [[book]]

Meh. Какой-то очень плоский рассказ

⥅ node [[lp]] pulled by Agora

📓 garden/flancian/lp.md by @flancian

a [[person]].
- [[friend]].
- One of my favourite people :)

⥅ node [[lp1]] pulled by Agora

📓 garden/flancian/lp1.md by @flancian

Lp1

An [[album]] by [[fka twigs]].
Recommended by [[snufkin]].

⥅ node [[lua]] pulled by Agora

📓 garden/melanocarpa/lua.myco by @melanocarpa

🌙Lua is a scripting programming language designed to be embedded in other systems by exposing a simple [[C]] API. The whole language is centered around one important data structure: tables.

=> permacomputing>Lua

=> https://redbean.dev

redbean is an open source webserver in a zip executable that runs on six operating systems. The basic idea is if you want to build a web app that runs anywhere, then you download the redbean.com file, put your .html and .lua files inside it using the zip command, and then you've got a hermetic app you can deploy and share.

redbean embeds Lua, SQLite, and MbedTLS into a fork() driven application server that benchmarks at 1.1 million qps on a personal computer. It's got a live bestline REPL with code completion and a UNIX module too, that lets you directly use the Cosmopolitan Libc system call interface. redbean furthermore provides sandboxing and system call tracing for security. This makes redbean a great fit for when you want to build an app that's vertically integrated into a single tiny file that runs on nearly all PCs and servers.

this is boiling hot

Alamantus [[says]] what's wrong with it:

Little inconsistencies in behavior across platforms, like saving files to the filesystem will work in one OS and not another (my current problem), sometimes some Lua will run and other times will just display a blank screen (this could be ignorance on my part, but theres also little communication from the server when things go wrong), and the documentation is incomplete in exactly the ways that frustrate me.

All in all, it makes me feel like the only people who can really use it well are those who are way smarter than me

⥅ node [[lw]] pulled by Agora

📓 garden/flancian/lw.md by @flancian

Lw

[[pull]] [[less wrong]]
LW might be an [[Agora]].

⥅ node [[mao]] pulled by Agora

📓 garden/neil/mao.md by @neil

Mao

⥅ node [[me]] pulled by Agora

📓 garden/flancian/me.md by @flancian

Me

[[pull]] [[flancian]]

📓 garden/s5bug/me.md by @s5bug

Me

[[pull]] [[Aly]]
[[pull]] [[s5bug]] to others

📓 garden/tilda/me.md by @tilda

me

hi! i'm tilda. i'm an aspiring full-stack [[dev]], and i like watching [[anime]] sometimes. also a [[person]] :).

my birthday is 01/03 (MM/DD).

if you'd like, you can check out my website at squiggle.cf

⥅ node [[mit]] pulled by Agora

📓 garden/bmann/_notes/mit.md by @bmann

⥅ node [[ml]] pulled by Agora

📓 garden/KGBicheno/Artificial Intelligence/Introduction to AI/Week 3 - Introduction/Definitions/Ml.md by @KGBicheno

ML

Go back to the [[AI Glossary]]

Abbreviation for machine learning.

⥅ node [[moa]] pulled by Agora

📓 garden/flancian/moa.md by @flancian

Moa

a collection of [[bridges]] and [[siphons]]
- [[go]] https://moa.party
  - [[moa]] bridges [[twitter]] and [[mastodon]]
  - it will soon also bridge [[instagram]] and the [[agora]]
- [[git]] https://gitlab.com/fedstoa/moa
- [[bugs]] https://gitlab.com/fedstoa/moa/-/issues
- Moa is developed with the vision that what really belongs to users should remain with users. Our personal and social data should always remain with us -- it is our property.
  - Perhaps eventually it will make it so that the particular client or [[gateway]] you use to interact with social networks ceases to matter; your social network becomes platform-agnostic in a sense.
- [[pull]] [[moa party]] [[fedstoa]]

https://twitter.com/flancian/status/1382050818241785856 https://twitter.com/flancian/status/1372986224495968266

📓 garden/moa-party/_notes/moa.md by @moa-party

Moa is the actual name of the server code that runs [[Moa Party]].

Code is developed on GitLab at https://gitlab.com/fedstoa/moa, and mirrored on GitHub at https://github.com/fedstoa/moa.

Check out the current [[Maintainers]].

⥅ node [[mp]] pulled by Agora

📓 garden/flancian/mp.md by @flancian

a [[project]].
- at [[work]], so I write about it only vaguely in public (like here).
- it's actually interesting, for which I'm thankful.

⥅ node [[mpd]] pulled by Agora

📓 garden/flancian/mpd.md by @flancian

a [[person]].
- #pull [[mpdominguez]]
- [[c5n]]
- [[2023-01-02]] told me about [[mithril]], the javascript library

⥅ node [[ms]] pulled by Agora

📓 garden/vera/ms.md by @vera

[[multiple sclerosis]]

⥅ node [[mtg]] pulled by Agora

📓 garden/jakeisnt/pages/mtg.md by @jakeisnt

I've been playing magic the gathering on and off for about ten years. my relationship with the game has changed – starting as something that resembles a board game, my understanding of the game adapted and i became a collector, then a competitor, then a collector again.

The company's management has made some bad decisions with respect to the game ecosystem, so I've quit.

Engines

https://github.com/magefree/mage https://github.com/stassa/Gleemin/blob/master/README the mtg project i was thinking about https://github.com/pitr/icfp2011 fun lambda the gathering language https://github.com/brokenthumbs/_boostertutor/blob/master/scryfall.py https://www.reddit.com/r/madeinhaskell/comments/hzuk08/magic_the_gathering_in_your_terminal/ play mtg in your terminal written in haskell! seems like a fun project to help out with.

⥅ node [[mtr]] pulled by Agora

📓 garden/jonathan/MTR.md by @jonathan

Master of Arts in Trandisciplinary Studies

meta #ZHdK

Master's degree program at the Zurich University of the Arts ([[ZHdK]])
webpage

⥅ node [[mvp]] pulled by Agora

📓 garden/flancian/mvp.md by @flancian

MVP

[[pull]] [[minimum viable product]]

⥅ node [[n-1]] pulled by Agora

📓 garden/flancian/n + 1.md by @flancian

#pull [[n plus one]] [[n]] [[1]]

⥅ node [[n26]] pulled by Agora

📓 garden/flancian/n26.md by @flancian

n26

a [[bank]]
- [[go]] https://n26.com
- [[quote]] the free bank account for your day to day

⥅ node [[nft]] pulled by Agora

📓 garden/evan/nft.md by @evan

[[People I have blocked]] [[opensea]]

📓 garden/flancian/nft.md by @flancian

nft

a [[thing]].
- [[pull]] [[nfts]]
- you can [[transmogrify]] anything into an [[nft]]; you get a different but related thing in the digital realm.
- [[wp]] https://en.wikipedia.org/wiki/Non-fungible_token
  - [[go]] [[w. e. b. du boisp]]

📓 garden/Jayu/NFT.md by @Jayu

[[Concept]]

[[Technology]]

[[Cryptography]]

[[Blockchain]]

[[Scratchpad]]

[[Licensing]]

[[Anti-NFT]] [[license]]s:
- [[Piero's Anti-NFT License]]: https://github.com/piemadd/PAN-License

📓 garden/melanocarpa/nft.myco by @melanocarpa

The so-called non-fungible token idea seems to be a threat to the society. Yet I still don't fully understand it to attack nft-folk.

The basic idea is simple. An NFT is an object that states that a particular object (a URL of a picture on a centralised website, quite often) is owned by a particular person. And it is backed up by some crypto blockchain, most often Ethereum.

=> https://www.youtube.com/watch?v=wDtt24RxdLk | Solar Sands: Why are NFTs so Ugly? [YouTube]

This video discusses why the design of many popular NFT collections is often considered ugly. Well, for reasonable reasons.

img side { https://images-wixmp-ed30a86b8c4ca887773594c2.wixmp.com/f/d457e81b-8fff-4551-bf7b-041a87f7a8fd/d9973nz-23a7327b-ca5b-47b2-a205-52c5e6e422c3.jpg?token=eyJ0eXAiOiJKV1QiLCJhbGciOiJIUzI1NiJ9.eyJzdWIiOiJ1cm46YXBwOjdlMGQxODg5ODIyNjQzNzNhNWYwZDQxNWVhMGQyNmUwIiwiaXNzIjoidXJuOmFwcDo3ZTBkMTg4OTgyMjY0MzczYTVmMGQ0MTVlYTBkMjZlMCIsIm9iaiI6W1t7InBhdGgiOiJcL2ZcL2Q0NTdlODFiLThmZmYtNDU1MS1iZjdiLTA0MWE4N2Y3YThmZFwvZDk5NzNuei0yM2E3MzI3Yi1jYTViLTQ3YjItYTIwNS01MmM1ZTZlNDIyYzMuanBnIn1dXSwiYXVkIjpbInVybjpzZXJ2aWNlOmZpbGUuZG93bmxvYWQiXX0.RxmuWjQNaMJOcbC_Ekd2PQdpwSVxH53TJDQWPlov8VE }

The video also mentions the drama of Qinni, the artist. After her death, some person has stolen her drawings and sold them as NFTs, getting profit. This is both theft and impersonation, so I find it disgusting. See [[sins]] for an incomplete list of things I find disgusting.

You can take a look at Qinni's drawings on [[DeviantArt]]. She also has an account on Twitter and Instagram, but I won't link them here. There's a picture drawn by her nearby in this article. It is sourced from DeviantArt's servers and may break any day.

This is what her brother said in the comments of the video:

Hey, Qinni’s brother here. I just wanted to say that I definitely appreciate your inclusion of my sister’s case of art theft here, but it is really far, far away from being a unique case. A lot of the theft came from opensea, and I found out about it first from my classmate, and then from a lot of other well-known artists seeing their own artwork being stolen in much the same way. A lot of it was also seen through DeviantArt’s NFT search mechanism.

Throughout her art career my sister’s art has constantly been stolen, and although my sister tried to combat this theft most of the time, the sheer popularity of my sister’s art would basically mean that theft is, in one way or another, inevitable. Now that I’m the custodian of my sister’s legacy, even though I would be the person responsible for chasing down any art theft, I simply do not have the energy or time to chase art theft down, and (fortunately) most of my sister’s fans understand this.

Nonetheless, I have noticed that NFTs definitely have facilitated art theft in a pretty unforeseen way, and (admittedly anecdotally) I’ve seen many other well-known artists see a definite uptick in these instances. Even though I’m aware that not all people who choose to partake in the activity are necessarily “bad people”, and there are some small artists who have managed to use them to support themselves in a meaningful way; I cannot get behind the technology and will not use it myself in the foreseeable future. I see many of its downsides to be quite similar to that of the fine art auctioning world, in that it is definitely a tool that facilitates fraud and laundering schemes. That, combined with its very decentralized and unpredictable environment, leads me to believe that this kind of facilitation to theft and rampant speculation is very much inherent in the technology, at least for the foreseeable future; and the very intense craze about it also leads me to believe that there’s a good chance that it will go bust (even though, admittedly, I don’t have a crystal ball).

All in all, seeing the way NFTs have facilitated the theft of my sister’s work, I cannot in good faith participate in the system, probably ever. I’m happy for small creators who may have managed to support themselves through them, but I am personally against it.

=> https://hyperduh.medium.com/%D0%BD%D0%B5-%D0%B2%D0%B0%D1%88%D0%B8-%D0%B1%D1%80%D0%BE-%D0%BF%D0%BE%D1%87%D0%B5%D0%BC%D1%83-%D0%BA%D1%80%D0%B8%D0%BF%D1%82%D0%B0-%D0%B8-nft-%D1%85%D1%83%D0%B4%D1%88%D0%B5%D0%B5-%D1%87%D1%82%D0%BE-%D1%81-%D0%BD%D0%B0%D0%BC%D0%B8-%D1%81%D0%BB%D1%83%D1%87%D0%B8%D0%BB%D0%BE%D1%81%D1%8C-f8b57be3d550 | Не ваши бро: почему крипта и NFT — худшее, что с нами случилось Длинная статья о том, как и почему это плохо. Я не дочитал, но вроде круто. Оставляю здесь как [[bookmark]].

=> http://thoughtstorms.info/view/AgainstNFTs

=> https://mstdn.social/@TrechNex/107966527625715466 | @TrechNex@mstdn.social 2022-03-16

Apparently WinAmp and Instagram are both doing NFTs now, and I am so tired.

=> https://shkspr.mobi/blog/2022/01/nfts-means-the-future-value-of-art-is-zero/ | NFTs means the future value of art is zero

But, here's the thing… you can only listen to one album at a time. That huge collection of music you have is mostly sitting idle. So why not turn your library into a tradeable asset?

The idea of NFTs is conflicting and I'm strongly inclined to call it heresy. But I'm not sure yet.

📓 garden/neil/nft.md by @neil

NFT

📓 garden/vera/nft.md by @vera

⥅ node [[nhs]] pulled by Agora

📓 garden/neil/nhs.md by @neil

NHS

⥅ node [[nix]] pulled by Agora

📓 garden/jakeisnt/pages/nix.md by @jakeisnt

Nix is a functional package manager that isolates and sandboxes dependencies.

Tools

nixos-infect: install nixos over an existing os on digitalocean and other vps systems devshell: universally compatible nix-shell

Tutorials

Resources for learning more about the Nix ecosystem The de-facto introduction to NixOS Another great introduction to the Nix ecosystem. This has better overviews of technology like overlays than the official documentation. Using Nix to manage Emacs packages (Emacs). Rycee's configuration is a good start or source of inspiration for this. Why Nix: Cachix, niv and nix-build overview Set up a basic git server with NixOS Set up Nix with preconfigured SSH

Setting up GnuPG + Yubikey on NixOS for SSH authentication: Super useful article for getting GPG to function with a yubikey and all of that. Subkeys - Debian Wiki is another great guide for creating and managing these keys.

Nix shorts: Lots of quick and helpful Nix tips to check out.

Building derivations at the Nix REPL
Installing packages from files and derivation expressions
Working with Nix shells
Creating derivations

NixOps

An evaluation of and tutorial for Disnix and NixOps nixops-tutorial: development with NixOps Hydra (and nixops) manual nixops user guide

MacOS

Provisioning a Nix server from MacOS

Server

nixos router for the homelab – useful for learning to set everything up installing and configuring nixos on linode Running NixOS on a consumer NAS

Evaluation

Why NixOS?

src src2 what is nix?

It's the simplest way to quickly iterate and try new programs. From `nix-shell` to `nix-env` to configuration options like `windowManager.xmonad.enable`, it's incredibly easy to swap parts of your system in very few lines of code. A lot of the grunt work has been done already to ensure that common configurations are perfectly functional and reproducible out of the box.
It's trivial to revert the state of your system. All it takes is booting to a previous NixOS interation.
Declaring SystemD services happens in one place and is incredibly simple! No more managing configuration files scattered throughout your computer - you can 'metaprogram' them in Nix and serialize the files out to disk. This applies to lots of other types of files, too; I use templates to manage color schemes for all of my applications, for example.
It's incredibly simple to set up reproducible build environments for writing and running code, especially in sandboxes when you don't want to confuse your globally installed programs.

Building within Nix

Gemini Portal: An evaluation of building an operating system "underneath" Nix/OS; building bottom-up to provide some interface that adheres to the Nix project expectations and specifications. (It failed and this is an evaluation of why).

Nix vs. Docker

src src2 src3 (has good NixOps tutorial too) Nix vs Docker for local development

Docker image is a snapshot of a machine that was assembled by running commands in a particular fashion
Making changes to the machine introduces nondeterminism; shell commands typically fetch information from outside sources that aren't pinned, so they change over time, and the functionality of your container will change as time progresses. Builds in Nix when properly pinned will not diverge the same way other deployment systems do.
There is no absolute guarantee that your Docker image produces the same image every rebuild
Nix runs natively, while Docker requires a Linux virtual machine
Nix can run as any user without particular privileges

Configs

My personal configuration:

Wayland enabled
Incredibly modular with thorough abstractions (in progress…)
Robust configuration of many programs, including mail server

hlissner's config

Heavily inspires mine - I forked his
Incredibly modular and allows for easy, opinionated program configuration
Some basic modular support and great library utilities
Consistent and comprehensive theme work

Graham's NixOS config:

ZFS with remote backups
Wayland dedicated
Start all programs in SystemD cgroups
Erase systems on every boot

bjornfor config:

Lots of home automation utility configuration; zigbee, home audio management, etc.
Custom derivations for tons of obscure programs corresponding to the above
Backup service infrastructure across multiple devices
Wonky configuration for chromium, networking, VPNs, etc. Very thorough management of loads of different devices.
Has pirate radio and torrent setups as well if you're into that

bqv:

Makes substantial use of nix flakes, properly managing them as overlays
Way over my head… come back to this later! I haven't fully looked through this one.

Soxin and cfg:

A modular NixOS configuration system and language
(How can I improve upon these ideas?)
I haven't fully examined this one.

colemickens:

I haven't fully examined this one either. Looks thorough, uses flakes and is constantly updated.

nixexprs:

Sourcehut-based CI configuration. Tons of good networking to inspire, plus a decent organization system. The system has IPFS, MacOS configuration, tons of default packages, and more. Could be used as a flake to install some of their packages; looks like it's compatible with NUR.

Installation

Good practices

Create a separate partition for all of your nix derivations, /nix
Label all of your disks so that `hardware-configuration.nix` is reproducible

initial installation

worth noting that what i found the most confusing was:

user configuration
vps specific, ensuring that i could remove the virtual disk (not delete it)

and log in as an unprivileged user without booting to the installation disk

partition

partition for space for nixos sudo fdisk /dev/sda new partition sector1 no selection for start of partition no selection for last sector w to write to disk

sudo mkfs.ext4 -j -L nixos /dev/sda1

Installation Outline

Make sure to name your disks; some configurations use some disk names by default.

nixos-generate-config –root /mnt

Edit /mnt/etc/nixos/configuration.nix.

Uncomment:

localization for us
terminal font and keymap
timezone = America/NewYork, America/Los_Angeles, etc. These are defined somewhere on your system.

UEFI systems:

You must set the option boot.loader.systemd-boot.enable to true. nixos-generate-config should do this automatically for new configurations when booted in UEFI mode.
Look at options with boot.loader.efi and boot.loader.systemd as well.

To dual boot, supposedly boot.loader.grub.useOSProber can be set to true to add other OS to the grub menu. This failed when I tried it (I may have accidentally damaged the partition table, though) but it might work for you.

You may have to manually start the SSH daemon: `sudo systemctl start sshd`

Pro tips

If the configuration isn't running properly after successfully refreshing it, you can use `nixos-rebuild boot` instead of `… refresh` to use the new configuration on the next boot but not enable it immediately. The `nixos-rebuild` utilities aside from `switch` all come in handy when fixing a broken configuration.
Write your own script to wrap common Nix commands. The command-line utilities aren't great, but you can just wrap others to create your own! (Who in their right mind would provide so many different names for programs `nixos-rebuild`, `nix-env`, `nix-shell` – it's difficult to know which one to even query the manpage for unless you're very familiar with Nix(OS) already.)

Future configuration ideas

Adjust system volume based on context Thunderbolt system utility; investigate if any issues arise cool config trick for installing chrome extensions set up software defined radio! Run programs in systemd cgroups (check out grahamc's config) this does some crazy things with subvolumes to automatically set up a btrfs system with nixos, including initial mounts

Nix tools

Swiss knife for updating nix packages. SSH Completions for Nix ssh plugin that lets you use zsh in nix-shell shell. cleverca22/not-os: An operating system generator, based on NixOS, that, giv Make a service abstraction layer · Issue #26067 · NixOS/nixpkgs: Abstract over systemd dustinlacewell/dotfiles: Nix configuration for all my workstations and serv workstation ux brainrape/nixform: define terraform infrastructure in nix brainrape/nixos-tutorial: one hour, hands-on Sander van der Burg's blog: Using Disnix as a simple and minimalistic depen Building static Haskell binary with Nix on Linux · PatchGirl Neuron 0.6 released: future-proof note-taking tool written in Haskell, Nix Searching and installing packages in NixOS - NixOS stites/haskell.nix-niv NixOS on ZFS - NixOS Wiki Encrypted /boot on ZFS with NixOS brainrape/nixform Discovering Nix: Provisioning a static webserver with NixOps Continuously Delivering this Blog with Nix, Hugo and CircleCI configuring infra in nix https://davedellacosta.com/posts/2019-03-29-why-nixos-is-hard-and-how-to-fix.html https://github.com/dustinlacewell/dotfiles https://github.com/nix-community/nixos-generators image builders for nix https://github.com/nix-community/todomvc-nix: canonical example for nix, works with or without flakes apparently. https://lemire.me/blog/2020/05/22/programming-inside-a-container/ programming inside of containers https://unix.stackexchange.com/questions/522822/different-methods-to-run-a-non-nixos-executable-on-nixos https://github.com/NixOS/nixpkgs/issues/26067 making a nix service abstraction layer, abstracting over systemd to produce a more generic solution https://grahamc.com/blog/erase-your-darlings https://gitlab.com/vdemeester/home this seems like a config worth looking through! debugging a dynamic linking bug in a nix project danielfullmer/robotnix: Build Android (AOSP) using Nix Mobile

TODO RSS reader written in Haskell and Ur/Web : haskell

Captured On: [2020-10-18 Sun 15:12]

Flake tips

Do not be afraid to use the –help flag! I've learned a lotfrom it.

Update a specific input: `nix flake update –update-input spicetify-nix` do

Go

{ lib, buildGoModule, fetchFromGithub }:
# buildGoModule can be pulled in from the package
buildGoModule rec {
  pname = "mangadesk";
  version = "0.0.1";
  # fetch the derivation from wherever
  src = pkgs.fetchFromGitHub {
    owner = "darylhjd";
    repo = "mangadesk";
    rev = "v${version}";
    sha256 = "1kgb5k55fxjcf1829fkp7wyd162391am9zhfgl50a606rlsfsh7h";
  };
  # this is an intermediate sha256 that is spit out when the derivation fails, somehow. needs more work!
  # vendorSha256 = "1879j77k96684wi554rkjxydrj8g3hpp0kvxz03sd8dmwr3lh83j";
  subPackages = [ "." ];
  deleteVendor = true;
  runVend = true;

  meta = with lib; {
    homepage = "https://github.com/darylhjd/mangadesk";
    description = "Terminal client for MangaDex";
    license = licenses.mit;
    maintainers = with maintainers; [ jakeisnt ];
    platforms = platforms.linux ++ platforms.darwin;
  };
}

void overlays for optimisation

Rationale: overlays end up creating additional copies of `nixpkgs` every time they're applied to `nixpkgs` and we retrieve a new package store. It's apparently currently impossible to understand what exactly this overlay has changed to create the new package set, so this new variable is declated as a new instance of nixpkgs being evaluted.

Instead, directly forward your inputs to your outputs, making sure that all dependencies follow nixpkgs, and declaring in flakes that they all follow the same nixpkgs deps.

⥅ node [[nlu]] pulled by Agora

📓 garden/KGBicheno/Artificial Intelligence/Introduction to AI/Week 3 - Introduction/Definitions/Nlu.md by @KGBicheno

NLU

Go back to the [[AI Glossary]]

Abbreviation for natural language understanding.

⥅ node [[now]] pulled by Agora

📓 garden/flancian/now.md by @flancian

An [[interesting]] [[context]].
[[hashtags]]
write [[agora bootstrap]] script.
[[paused]] for [[tea]]
- wow, that was a long tea. life happened :)
- resuming today, [[2022-05-08]], after talking to my mum.

📓 garden/jakeisnt/now.org by @jakeisnt

Moving to Stockholm
Learning more about GUI development on all levels of abstraction
Studying architecture and industrial design (hard to do outside of the classroom!)
Figuring out how to make a computer fun for people to use

📓 garden/melanocarpa/now.myco by @melanocarpa

This is my [[Now page]]. From time to time, not often, I shall update this page. It says what I am generally about currently. Last updated: ~~2023-04-30~~ ~~2023-06-13~~ ~~2023-06-17~~ ~~2023-08-02~~ ~~2024-01-01~~ 2024-09-24.

= University + dayjob During the sixth semester, started a part-time Go internship at a bank. Finished both the semester and the internship well, got hired as a full-time Junior. Working during the summer and start of autumn. The BRICS summit delayed the start of the seventh semester, which helps me.

Now a professional cog of the Babylon mechanism. With the new money, moved from the dorm. Life quality leveled up.

Don't know yet how will I work during the seventh semester. Perhaps, I shall not.

= Travel During May, traveled to Saint-Petersburg to visit Danila. September, he visited me back. Fun!

Had a work trip to Krasnaya Polyana. That's some fun work trips we have.

= Programming New releases of [[Betula]] and [[Mycorrhiza]] don't happen as often as I want them to. Had a chance to present Betula as a course work, that was great.

= Art The comic anthology I took part in kinda disappeared. Oh whatever, I don't even care now. Drawing sometimes. Creating a secret [[aronia zine]].

= Plans for 2024

Get a job
Maybe move away from the dorm
Work on Betula federation
And the very personal stuff too

Mostly done.

⥅ node [[nox]] pulled by Agora

📓 garden/flancian/nox.md by @flancian

Nox

One of my [[computers]].

⥅ node [[np]] pulled by Agora

📓 garden/s5bug/np.md by @s5bug

NP

class of languages whose membership proofs can be verified in polynomial time
the [[discrete-log]] problem is an example of an NP problem
- from $g^x$ in a finite field it is hard to compute $\log_g\left(g^x\right)$, but easy to check $g^x = g^y$ to validate a knowledge proof of $x$

⥅ node [[nts]] pulled by Agora

📓 garden/flancian/nts.md by @flancian

Nts

a [[radio]]
- Love [[slow focus]]: flancia.org/go/slow-focus.

⥅ node [[ntv]] pulled by Agora

📓 garden/flancian/ntv.md by @flancian

ntv

a [[playlist]]
- [[go]] https://www.youtube.com/playlist?list=PLEPdrRZBv9Sz_dfWTsMTOVkb4_Q1CN30q

⥅ node [[ocr]] pulled by Agora

📓 garden/vera/OCR.md by @vera

optical character recognition

convert images of words into text form

⥅ node [[ogm]] pulled by Agora

📓 garden/flancian/ogm.md by @flancian

a [[group]].
- #pull [[open global mind]] [[collective sense commons]]
- #pull [[fotl]]
- #chat https://chat.collectivesensecommons.org/
  - [[mattermost]]
- #go https://collectivesensecommons.org/

⥅ node [[oil]] pulled by Agora

📓 garden/neil/oil.md by @neil

Oil

Most oil deposits are thought to have been laid down between 10 and 180 million years ago, when dead zooplankton and algae sank to the seafloor and were buried in layers of sediment, before being slowly transformed into hydrocarbons by heat and pressure and time

– [[Wasteland]]

⥅ node [[os]] pulled by Agora

📓 garden/jakeisnt/pages/os.md by @jakeisnt

Operating Systems

Operating systems run your computer! There are lots of innovative OS projects but only a few are really used. A few more than those have some interesting ideas. Expanded Main Page - OSDev Wiki has tons of resources on building an operating system.

Projects

Desktop

Aside from Linux, Windows, MacOS and derivatives…

IlluminOS
An operating system that claims to provide advanced system debugging, a next-generation file system, networking and visualization.

https://ameliorated.info/
Windows 10 with the crap removed

DawnOS
An operating system built on the subleq higher level language architecture. See the video for a detailed overview!

Redshirt
Redox :: is a Rust operating system with a microkernel-based design.
Urbit :: A 'universal function'.
MetalOS :: A hobby project written by a single person.
InterimOS :: Written to accompany mntmn's custom hardware.
CirnOS :: An operating system that transforms a Raspberry Pi into an Arduino. effectively.
Demikernel :: interesting approach to architecture
CrysaLisp :: A next-generation Lisp machine.
TempleOS (racist)
CollapseOS :: An OS written entirely in the Forth programming language.
Fuschia :: Google's up-and-coming unified desktop and mobile operating system. Presumably similar to Linux-SE (Android). https://blog.quarkslab.com/playing-around-with-the-fuchsia-operating-system.html
Gentoo :: An operating system that prides itself on building everything from source. Leaving Gentoo https://www.paritybit.ca/blog/my-beginnings-with-gentoo https://timboudreau.com/blog/gentoo/read gentoo seems like a great learning exp https://wiki.gentoo.org/wiki/Raspberry_Pi#Hardware help loading gentoo onto a pi {might be more helpful to put on qemu}
Qubes OS :: An operating system that isolates every application and device on the computer, granting permission to each only when necessary. Many journalists and security professionals rely on this.
WhoNix :: An operating system designed to completely sandbox your activity inside of a virtual machine.
Plan9 :: Defer to Devine's notes on the subject.
- Plan9 resources: http://www.9gridchan.org/
- Plan 9 System Calls
- plan9 tools for unix operating systems
Junos OS
Spectrum :: An OS modeled after Qubes, but making full use of the Nix reproducible build system, and dedicated to supporting mainstream x86-64 hardware.
SmartOS :: combines opensolaris tech with linux kvm virtualization. has zfs. contributed to illumos project

Mobile

https://news.ycombinator.com/item?id=23100713

LineageOS
The most popular alternative Android operating system, built off of CyanogenMod. https://wiki.lineageos.org/devices/starlte/install https://www.reddit.com/r/degoogle/comments/gu2kk9/lineageos_vs_e_vs_alternatives/

e
An operating system designed to function efficiently on older, refurbished devices. Built on LineageOS.

NixOS Mobile
A full port of NixOS to a mobile platform. It's built on top of many previous efforts and relies on a tool to convert GTK applications to mobile equivalents.

Hobby

I got my Gameboy emulator running in my OS! : osdev. This is so inspirational. I love it. I would love to play this game boy game on this operating system. It sounds so fun and satisfying to have made and to use a stack like this!

Other

http://songseed.org/dinghy/concept.html reenvisioning the os Operating Systems: Three Easy Pieces Books hobby operating system written in C https://www.reddit.com/r/osdev/comments/husrzq/looking_for_a_specific_tutorial_from_10_years_ago/ macos emulation layer for linux toy os https://blog.twitter.com/engineering/en_us/topics/open-source/2020/hunting-a-linux-kernel-bug.html demikernel/demikernel: Demikernel OS nickbjohnson4224/rhombus: a hobby operating system written in C jmgrosen/shorai: A super-amazing OS that will bring world peace. Demikernel cleverca22/not-os How to Protect Your Privacy on Linux well known operating systems course at upitt just in time specialization for opencl kernels http://c9x.me/articles/gthreads/intro.html trigger kernel races reliably kabbi/wonderland: Inferno clone to conquer the world http://intermezzos.github.io/ a demo operatin system for learning https://littleosbook.github.io/ the little book of of development https://en.m.wikipedia.org/wiki/Genode http://wintermute.org/brendan/ the screenless office and other artistic efforts https://github.com/mkilgore/protura toy os kernel and utilities https://makelinux.github.io/kernel/map/ map of the linux kernel https://www.mercuryos.com/ reengineering of the operating system as a ux project, fluid experience driven by human intent https://github.com/ssrg-vt/hermitux binary compatible unikernel https://github.com/oasislinux/oasis statically linked linux system https://github.com/dlannan/ljos luajit command line os https://news.ycombinator.com/item?id=10957020: overview of real alternative operating systems for considering. lots of interesting innovations!

GitHub - jzck/kernel-zig: hobby x86 kernel zig: Cool microkernel rolled with of Zig

⥅ node [[osu]] pulled by Agora

📓 garden/tilda/osu.md by @tilda

osu!

a "free-to-win" rhythm game developed by Dean Herbert (a.k.a. "peppy") in which you click circles.

where can i get it?

it is available as a download for windows on its website - works well on wine as well, for mac/linux users

⥅ node [[osx]] pulled by Agora

📓 garden/bmann/_notes/osx.md by @bmann

Command Line

Convert SVG to PNG

Use brew to install rsvg-convert:

brew install librsvg

Run rsvg to convert SVGs to PNGs. The numeric argument is the height in pixels, the width is done automatically.

rsvg-convert -h 512 filename.svg > filename.png

You can also use [[Automator]] to make a drag-and-droppable app to drop files onto:

Screenshot 2019 05 02 16 43 42 {: .internal-link}

⥅ node [[p-c]] pulled by Agora

📓 garden/flancian/p c.md by @flancian

P. C.

A [[person]].
Old [[friend]].
[[Calafate]].
[[Agustina]].

⥅ node [[p2p]] pulled by Agora

📓 garden/neil/p2p.md by @neil

P2P

⥅ node [[pad]] pulled by Agora

📓 garden/flancian/pad.md by @flancian

Pad

A [[pad]] is a group resource: a common notebook where a group of people may write in.
- It can be a [[wiki]], a [[google doc]], an [[etherpad]].
The [[agora]] wants to integrate with all available public pads (that are willing).
- Each [[agora]] node comes with at least one [[pad]] built in: it is a public, world-writeable text field. You can find it right here below.
- If you [[pull]] a pad, and by this I mean you write [[pull]] <some url> in the [[agora]], the agora will try to [[transclude]] or [[embed]] it here.

⥅ node [[pip]] pulled by Agora

📓 garden/flancian/pip.md by @flancian

pip

The package installer for Python.
- Depending on the version you might need to run pip or pip3 to use it. I use pip3 in my systems.
[[install]]
- [[debian]] apt install python3-pip
- [[osx]] curl https://bootstrap.pypa.io/get-pip.py -o get-pip.py && python get-pip.py
- [[windows]] pending

⥅ node [[pkd]] pulled by Agora

📓 garden/flancian/pkd.md by @flancian

pkd

[[pull]] [[philip-k-dick]]

⥅ node [[pkm]] pulled by Agora

📓 garden/flancian/pkm.md by @flancian

Pkm

[[pull]] [[personal knowledge management]].
- the [[agora]] is an integrator of [[vaults]]/[[digital gardens]] as volunteered by users of personal knowledge management systems.
  - [[distributed knowledge graph]].
- [[pull]] [[roam-likes]]

📓 garden/karlicoss/pkm/pkm.md by @karlicoss

[2020-03-20] Use phones to collect and triage, not (usually) to read
[[Tweet from @jborichevskiy]]
[[https://github.com/alphapapa/transclusion-in-emacs]] [[transclusion]] [[emacs]]
[[related]] [[learning]]
[2018-11-09] WorldBrain/Memex: Browser Extension to full-text search your browsing history & bookmarks. [[worldbrain]] [[annotation]] [[promnesia]]
- [2019-03-23] hmm, all data stored locally… wonder if could integrate with wereyouhere..
[2020-05-06] Memex Dreams ‒ Szymon Kaliski [[pkm]]
- [2021-01-04] good description of the pkm process, probably similar to mine
[[personal knowledge management]] [[think]]
- [[fuzzy thing to launch MC in specific directory]] [[pkm]]
[[shit, sometimes it just doesn't annotate on the first invokation]] [[hypothesis]]
- [2019-05-05] ugh… seriously, just open new link, click hypothesis button and hightlight. refresh the page; hightlight is gone :(
- [2019-12-17] I think it's resolved??
[2019-06-05] The rise of Personal Knowledge Management tools
- [2019-07-02] read them more? https://no-kill-switch.ghost.io
[2018-11-19] Do you guys have a personal wiki? (using org-mode or not) /r/emacs [[exobrain]] [[org]]
[[eh maybe use some markdown-based organiser just for search? and reuse my exobrain script for export]] [[phone]] [[pkm]]
- [2020-08-26] markor?
[[I want to see a piece of information **once**, unless I explicitly want otherwise (i.e. spaced repetition)]] [[motivation]]
[[Just use roam style links?]] [[pkm]]
[2020-05-15] WorldBrain.io on Twitter: "So much good stuff in the upcoming Memex 2.1. ⭐️ Add all open tags to lists and tags via the sidebar ⭐️ 80% less resource usage ⭐️ Tons of performance improvements (no more fans from hell) ⭐️ More stability" / Twitter [[worldbrain]]
[2020-05-19] WorldBrain's Memex: Bookmarking for the power users of the web | Hacker News [[worldbrain]]
[2020-05-11] Vision, Mission & Values — 2020 Update - WorldBrain.io - Medium [[annotation]]
[[firefox saved searches via bookmarks actually get synced?]] [[pkm]] [[totweet]] [[toblog]]
- [2020-07-06] right, so it seems to be exactly equivalent, and works without extensions
[[proper search with recoll could be useful when there are too many results?]] [[pkm]]
[[Perhaps most prominently, the creator of the SuperMemo system, Piotr Wozniak, has written extensively about the many ingenious ways he uses memory systems]]
[[Show HN: Fraidycat]]
[2020-03-16] Conor is Hiring for Roam (DMs open) Designers esp. on Twitter: "The Zettelkasten. "It's like the GTD for intellectual progress" What it is, and why you want one. (thread)" / Twitter [[pkm]]
[2020-07-26] posobin/ampie: Social navigator for the web
- [2020-07-26] Gleb Posobin on Twitter: "Published ampie for Firefox! https://t.co/e9pTwO8uuz History doesn't work as well as on Chrome yet though. Also published the extension's source code under the MIT license: https://t.co/VlBPKiH0QU https://t.co/mT2z3qHSJy" / Twitter
  - [2020-08-21] https://addons.mozilla.org/en-US/firefox/addon/ampie/ rate it
[2017-11-01] thoughts on my own todo app [[pkm]] [[think]]
- [[Super important task are reminders]]
- [[choose postpone length (in org?)]]
- [[scheduling day: starts at 05:00, ends at 04:59. 05:00 I am most likely to sleep]]
- [[postpone -> find next compatible slot]]
- [[Neural network with pairs?]]
- [[to be honest, I should just check with calendar more often and it would all be fine]]
- [[Might be overly conservative?]]
- [[Examples:]]
  - [[You're going skiing to switzerland on wednesday. You bought new boots on Sunday and wore them all day. You might rub your feet so you might be unable to ski. Can we prevent it?]]
  - [[dentist]]
[[Internet Search Tips - Gwern.net]]
- [2019-06-13] archiver-bot: automatically archive your web browsing and/or links from arbitrary websites to forestall linkrot; particularly useful for detecting & recovering from dead PDF links
- [2019-06-13] Useful tools to know about: wget, cURL, HTTrack; Firefox plugins: NoScript, uBlock origin, Live HTTP Headers, Bypass Paywalls, cookie exporting. Short of downloading a website, it might also be useful to pre-emptively archive it by using linkchecker to crawl it, compile a list of all external & internal links, and store them for processing by another archival program (see Archiving URLs for examples).
[[Single file html]] [[linkrot]]
[Tweet from Andy Matuschak (@andy_matuschak), at Dec 30, 03:23](#twtfrmndymtschkndymtschktdc TIDDLYLINK) [[pkm]]
[[https://github.com/WorldBrain/Memex-Mobile]] [[worldbrain]]
[2020-03-17] (1) Szymon Kaliski on Twitter: "📓 published muninn - set of cli tools, and vim plugin, for managing my personal flat-file markdown-based wiki, including @RoamResearch-like backlinks, todo management, minimal web ui, and more! https://t.co/Zg3RGjOcva" / Twitter
[2020-05-09] Thinking by Writing ‒ Szymon Kaliski [[writing]]
[[Honorable Mentions: Memex by Worldbrain.io, Roam Research, Notion, Coda.io, Alfred, Trove, Local Native, ArchiveBox, Raindrop]]
[2020-06-19] Abdillah/hypothesis-firefox: Unofficial. Hypothes.is Firefox addon for annotating anywhere!
[[Tweet from @Conaw try foam?]]
[[jborischevsky: https://news.ycombinator.com/item?id=21747852]] [[pkm]] [[infra]]
[2019-12-05] Profile: h0p3 | Hacker News [[pkm]] [[exobrain]] [[people]]
[[Need a tool to match and highlight arbitrary text in pdf]] [[annotation]]
- [2019-06-13] I gues polar mostly works
[[Organize pdf, search for duplicates]] [[pkm]] [[polar]]
[[figure out a way to classify pdfs I have. I should mark them at the time of download, otherwise I forget]] [[pkm]] [[study]]
- [2019-02-10] ok, maybe just make sure I always highlight interesting bits?
- [2019-06-13] again, polar mostly ok
[[track all pdfs I ever had. in the simplest approach, just have a binding to archive it]] [[pkm]]
- [2019-06-13] polar got pdfs
[[use zzzfoo for recoll (F2)]] [[pkm]] [[habit]]
- [2019-06-13] not sure about that… I guess rofi is not the most convenient interface after all… need something that doesn't go away easily, maybe some different window mode?
[[look up stuff in pinboard tags. also I need to export my org link collection to pinboard too]] [[pkm]]
- [[I guess compute diff and approve each item]]
- [[hmm, actually now I might be able to do that via porg?]]
[[tool to automatically explore a user for the tags I'm interested in?]] [[pinboard]] [[pkm]]
- [2019-07-30] hmm, axol kinda does that… [[axol]]
[[two separate areas: structured notes and unstructured]] [[pkm]] [[think]]
[2019-02-10] figuring out if it's ok as pdf viewer [[polar]] [[pkm]]
- [[minor ui issues (e.g. tagging)]]
- [[would be nice to be able to tag via polar viewer]]
- [[editing annotations]]
- [[hmm .stash dir – can we get away without copying files?]] [[polar]]
- [[would be cool to implement conversion into other hightlight formats and export]]
[2019-01-17] Deferential Geometry [[physics]] [[pkm]] [[wiki]] [[inspiration]]
[[would be interesting to regularly look for annotations on the same pages I have annotated]] [[pkm]]
[https://www.reddit.com/r/orgmode/comments/3b9bib/orgmode_for_humanities_research_notes_similar_to/cskh6an/](#swwwrddtcmrrgmdcmmntsbbbrfrhmntsrsrchntssmlrtcskhn TIDDLYLINK) [[org]] [[pkm]]
- [2019-05-14] ok, I could:
- [2019-07-27] if I find that useful, implement proper timer for reloading new files regularly. Find a way to answer y to opening in fundamental mode?
- [2019-08-20] ah right… it's sacha chua…
[GitHub - matthewmueller/x-ray: The next web scraper. See through the noise.](#gthbmtthwmllrxrythnxtwbscrprsthrghthhtmlns TIDDLYLINK)
[[hightlighting certain things on page based on whether it contains certain link? that way could simulate priorities anywhere]] [[pkm]] [[chrome]]
[[hmm do I need to clean old index?]] [[recoll]] [[pkm]]
[[search by org tags?]] [[pkm]] [[emacs]]
[2019-04-13] inspiration: renerocksai/sublime_zk
[2019-04-19] Post-Evernote: How to Migrate Your Evernote Notes, Images and Tags into Plain Text Markdown - Minding the Borderlands [[pkm]]
[[Designing better file organization around tags, not hierarchies]] [[pkm]] [[tagging]]
- [2019-05-05] a lot of various tag-based filesystems etc
[[make views into reddit comments? multiple blocks; fetch them regularly?]] [[toblog]] [[pkm]]
[2019-01-17] Welcome! [[physics]] [[pkm]] [[inspiration]]
[[Add display for read only pdf annotations?]] [[polar]] [[annotating]]
[[Tweet from ¬¬(Dan Piponi) (@sigfpe), at Mar 6, 18:54]] [[annotation]]
- [2019-07-30] split screen looks good
[2019-07-20] A very brief introduction to Personal Knowledge Management – Relatris Blog und Fundstücke [[toblog]]
- [2019-12-17] pretty vague motivation
[2019-06-20] Open Semantic ETL toolkit for data integration, data analysis, document analysis, information extraction & data enrichment
[[recoll web: search as you type??]] [[recoll]]
[[shit, couldn't figure out how to properly display with newline…]] [[recoll]] [[pkm]]
[[hmm, wonder how hard it'd be to build indexer]] [[search]] [[android]] [[pkm]] [[think]]
[[pdannots: failed to extract properly from Zee's book]]
[2019-06-13] Internet Search Tips - Gwern.net: Enable some kind of hotkey search with both prompt and copy-paste selection buffer, to turn searching Google (G)/Google Scholar (GS)/Wikipedia (WP) into a reflex.2 You should be able to search instinctively within a split second of becoming curious, with a few keystrokes. (If you can’t use it while IRCing without the other person noting your pauses, it’s not fast enough.)
[[use fmc in rofi?]]
[2019-09-04] howardyclo/Digestant: Modules for effectively digesting data from Twitter and Reddit using ML, NLP and statistics. [[pkm]] [[axol]]
[2019-08-25] Org-brain /r/orgmode
[2019-09-05] Kungsgeten/org-brain: Org-mode wiki + concept-mapping
[2019-09-05] rofi-scripts/rofi-finder at master · davatorium/rofi-scripts
[2019-07-23] neonion [[pkm]]
- [2019-08-09] eh, looks like you need to import the document in it http://neonion.org/userdocs/index.html
- [2019-09-15] also project hasn't been updated for a while
[2019-09-28] Orger: plaintext reflection of your digital self /r/orgmode
[[recoll: index downloads so it's easy to recall recent downloads? also nead to clean older indexed stuff]] [[pkm]]
[[Zeal]] [[search]]
[[Why Use Hyperbole (Use Cases)]]
[[helm-ag would be useful to exclude file]] [[people]] [[pkm]]
[[think which of my workflows could be made available for more general public and how]] [[think]] [[pkm]]
[2019-10-17] NOTE: A (Python 3) fork is actively maintained here · Issue 74 · koniu/recoll-webui
[2019-10-19] Doug's 1968 Demo - Doug Engelbart Institute
[2019-10-31] something similar to swoop for firefox would be nice. could implement in surfingkeys? [[think]] [[search]]
[[https://github.com/eli-oat]] [[people]] [[pkm]]
[2019-11-06] Brendan Schlagel on Twitter: "Petition to rebrand "personal knowledge management" > "personal librarianship" -broader remit (more to gain from reading than "knowledge") -sounds cooler & friendlier -could be a good theme / brand for https://t.co/Fd9MpAjnDj! (con: "personal librarian" has another meaning…)" / Twitter
[[Ask HN: How do you organize document digests / personal knowledge? | Hacker News]]
[[Special account that favs my interesting tweets for a feed]] [[pkm]] [[search]] [[toblog]]
[[Run linkchecker against all links produced by me]] [[pkm]] [[promnesia]]
[[Tags for hn via nlp summaries?]] [[hackernews]]
[[Guy who thought about pkm issues]] [[pkm]]
[[Ask on HN how to read it so it's fair to everyone?]] [[outbox]] [[pkm]]
[[find random python scripts around file system?]] [[pkm]]
[[What I wish I knew before joining Mastodon - By]] [[mastodon]] [[api]]
[[Managing my personal knowledge base | Hacker News]]
[2019-12-23] perkeep/gphotos-cdp: This program uses the Chrome DevTools Protocol to drive a Chrome session that downloads your photos stored in Google Photos. [[pkm]]
[error handling would be nice to extract as well, e.g. error_helper…](#rrrhndlngwldbnctxtrctswllgrrrhlpr TIDDLYLINK) [[exports]]
[[Except with google it’s becoming impossible to find links from several years ago… | Hacker News]]
[[maybe I need some sort of 'seen' state for stuff in links.org]] [[pkm]]
[[might be nice to keep 'iteration' of how often I explored the link]] [[pkm]]
- [2020-02-12] fuck, could actually integrate promnesia with emacs? that's be fucking insane. [[promnesia]]
[[need to treat tags and priorities as transient.. othewise too much friction]] [[pkm]]
[[Tweet from @blakeir]]
[2019-12-28] Tips on using the Remembrance agent? : emacs [[pkm]]
[[Orgzly Workflow Showcase?]]
[[Tweet from @rektide]]
[[the more I read news etc on PKM, the more it feels like I'm already on the cutting edge, know more than 99.99% of people about it and have collected all the low hanging fruit]] [[pkm]]
[2019-11-28] Profile: grblovrflowerrr | Hacker News [[people]] [[pkm]]
- [2019-12-03] https://news.ycombinator.com/threads?id=grblovrflowerrr
- [2019-12-03] https://www.notion.so/Building-Blocks-For-The-Future-Of-Computing-7f74066de66749d59939a91ab13ec960
- [2019-11-28] Yoshiki Schmitz
[[email/tweet at archive.org team about t.co links?]] [[hpi]] [[linkrot]]
[2020-05-01] Voice capture org-mode tasks on Android – Org mode Exocortex [[org]] [[dictation]]
[2020-01-16] axa-group/Parsr: Transforms PDF, Documents and Images into Enriched Structured Data
[2019-07-06] public voit - Homepage of Karl Voit [[german]] [[pkm]]
- [2019-07-06] git: post-commit hook for determining large number of deleted lines in Org-mode (paranoid) [[git]] [[setup]]
- [2019-07-06] My Personal Emacs History
- [2019-07-06] The Perfect Tool to Organize Your Digital Life (Emacs Org mode)
- [2019-07-06] Evolutional Steps of Computer Systems
- [2019-07-06] The Tag «decentralization»
- [2019-07-06] Going Back to Analog
- [2019-07-06] Karl Voit (@n0v0id) | Twitter
- [2019-07-06] About
- [2019-07-06] My Dependencies on the Cloud
- [2019-07-06] You Can't Control Your Data in the Cloud
[2019-09-26] Venkatesh Rao on Twitter: "1/ There are some interesting lessons in the failure of bookmarking as a category" / Twitter
[2019-10-17] jethrokuan/braindump: knowledge repository managed with org-mode and deft.
[[share feedbin subscriptions?]] [[self]] [[rss]]
[2020-05-13] TreeSheets
[[Tweet from @kwharrison13]]
[[https://github.com/Overdr0ne/sfs (search file system)]]
[2020-06-13] New Discord PKM community /r/Zettelkasten
[2020-01-30] (1) Ildar Karimov on Twitter: "@artem_zin @karlicoss Google desktop app was able to inject a lot of local/private data into search results but discontinued in 2011 :(" / Twitter
[2020-03-20] "🌞New Video: Combining Note-Taking and Spaced Repetition (SR) I talked about: 1. Integrating SR questions in permanent notes 2. adding SR questions while journaling 3. learning new words and phrases 4. using quick capture for SR https://t.co/OIvzV36bU5 https://t.co/iX1ZAzEcMs" / Twitter
[2020-06-11] OpenAI API [[pkm]]
[2020-07-01] Dan Girshovich - Zettelkasten [[pkm]]
[[Tweet from @mekarpeles]]
[2020-08-24] My takeaway from the recent trend in articles talking about how great the Zettel… | Hacker News
[[example/demo: enabling properties export for my blog]] [[elisp]] [[toblog]]
[[alraban/org-recoll: A lightweight emacs org-mode wrapper for the recoll full-text search engine]]
[[Group hn posts to figure out what to filter? Not sure..]] [[pkm]] [[hackernews]]
[[motivation for searching over my own posts: quick plaintext interface that works offline]] [[motivation]] [[pkm]]
[2020-03-09] Pinboard: Bookmark Detail
[2020-03-09] Pinboard: Bookmark Detail
[2020-03-09] Pinboard: Bookmark Detail
[2020-03-09] Pinboard: Bookmark Detail
[2020-03-10] Mesh on Twitter: "@Conaw hell to the yes. Roam is so powerful it needs to be at the OS level and maybe beyond. 🤖 I saw mercury OS and immediately thought of Roam, it just intuitively fit. https://t.co/84MtykKJLu" / Twitter
[[wonder if for me this roam thing could be replaced with 'virtual pages', based on properties?]] [[pkm]] [[roam]]
[[search in images with ripgrep-all (rga)]] [[setup]] [[pkm]]
[2020-04-11] David Laing on Twitter: "I'm stunned by @andy_matuschak's notes at https://t.co/DBxJzZrS2q—both their content and their form. I'm taking inspiration for my own site. I know almost nothing about web development, but yesterday I figured out how to make previews for internal links. Next up, backlinks! https://t.co/dNeJDOoKBG" / Twitter
[2020-04-13] The Curse of Xanadu: the longest-running vaporware in computing (1995) | Lobsters [[xanadu]]
[[Nototo is a spatial note-taking app. It lets you build an ever-expanding, topographical map containing your notes and writing. The app is designed this way to take advantage of another aspect of spatial interfaces: our brains remember spaces better than raw information. In this regard, Nototo is like a software manifestation of a memory palace.]]
[[blocking site from search]] [[search]]
[2020-07-03] america hater sarahzrf on Twitter: "god damn its nice to be able to just type a few keywords from a title into zotero's search instead of having to remember what shitty filename i saved something under" / Twitter
[Tweet from @andy_matuschak https://twitter.com/andy_matuschak/status/1278498290296745984](#twtfrmndymtschkstwttrcmndymtschkstts TIDDLYLINK)
[Tweet from @cj_pais](#twtfrmcjps TIDDLYLINK)
[[blog – move to phone (after reinstall?)]] [[pkm]]
[[archived stuff – use .ignore file?]] [[pkm]]
[[This is my personal human computer interaction interface https://github.com/codygman/hci]] [[search]]
[[have symlinks to files in my knowledge from the repositories? e.g. promnesia/hpi. allow following symlinks for certain types?]] [[pkm]]
[2020-08-26] logseq (@logseq) / Twitter [[pkm]] [[exobrain]]
[[Tweet from Nat Eliason (@nateliason), at Jan 9, 07:21]]
[2019-05-10] Markor v1.8 - All new file browser, favourites and faster Markdown preview /r/fossdroid
[[go through all the ANN documents, wonder if any annotations are inside…]] [[pkm]]
[[maybe instead of PKM use KM? the shorter it is the easier it is maybe?]] [[pkm]]
[2019-05-21] Keeping Found Things Found: The Book | Keeping Found Things Found [[pkm]]
[2019-07-27] Tweet from Andy Matuschak (@andy_matuschak), at Jul 27, 01:00 [[pkm]]
[2019-11-21] Samuel Breese [[pkm]]
[[comments duplicate..]] [[polar]]
[[Tweet from Tiago Forte (@fortelabs), at Aug 26, 04:03 How to read non-fiction books]] [[reading]]
[2019-01-17] RaRe-Technologies/gensim: Topic Modelling for Humans [[nlp]] [[infextraction]]
[2019-06-20] Download | Open Semantic Search
- [2019-07-23] https://www.opensemanticsearch.org/doc/datamanagement/annotation
  - [2019-07-23] looks a bit manual otherwise though
  - [2019-07-23] not many results on pinboard
[[pkm python package for quickly adding things to my todo list?]] [[pkm]]
- [2019-02-06] a python my.todos.add function would be cool
[[actually pinboard could be used as org export… or sync one tag from org to pinboard tag?]] [[pinboard]] [[pkm]] [[org]]
[[diagram of my tasks dependencies (also completed ones?)]] [[pkm]]
[2019-05-19] modifying reading stats (number of books read and hours read)? - MobileRead Forums
[2019-05-16] New tool: KM for digital collections/structured data /r/knowledgemanagement
[2019-05-16] Org-mode Hidden Gems - 03 Hyperlinks /r/orgmode
[2019-06-13] Juan Campa on Twitter: "Dataspace is a fascinating concept by @natecull, reminds me a bit of @urbit and of course Membrane. https://t.co/SNXwAeA46a… https://t.co/4gEnZHUO2K"
[2019-06-22] HowTo: Building Personal Index for Data Discovery - Virtuoso Universal Server / Tips, Tricks, and HowTos - OpenLink Software Community
[2019-04-05] zadam/trilium: Build your personal knowledge base with Trilium Notes [[pkm]]
- [2019-06-13] erm, I guess it's not plaintext…
[2019-06-27] Non-fiction books: a waste of time? o_O
[2019-09-05] Using Org-Brain
[2019-11-01] Youtoofy
[[https://github.com/dvorka/mindforger]]
[[RSS it not really helpful; doesn't show diff…]] [[github]] [[pkm]] [[rss]]
[2020-03-24] Metaformat · GitBook
[[Tweet from @Conaw Aspirations and inspirations thread https://t.co/YrwBJiP6dk]]
[[Tweet from @round]] [[axol]]
[[https://github.com/houshuang/Treeverse]] [[twitter]] [[pkm]]
[2019-08-06] Visakan Veerasamy on Twitter: "I usually talk about this in the context of personal knowledge management, about fun things like keeping track of quotes and riffs and blogpost ideas. Usually this is about me helping other (usually younger) scatterbrained people https://t.co/uPoy7Qw00j" / Twitter
[2019-09-20] vimoutliner/vimoutliner: Work fast, think well.
[2019-11-17] WICG/ScrollToTextFragment: Proposal to allow specifying a text snippet in a URL fragment
[[ugh, massive duplication in неореакция-конспирология. wtf???]] [[infra]] [[vk]]
[[Archived tag – prefix with underscore?]] [[org]]
[[Tweet from @Conaw]] [[pkm]] [[memory]]
[[Tweet from @RoamBrain]]
[2020-03-09] Pinboard: Bookmark Detail
[2020-03-13] tool for Twitter Timeline Search. Analytics & filters for Twitter Accounts [[twitter]]
[[right, urls separated by commas… not ideal?]] [[twint]]
[2020-04-26] How to annotate literally everything | beepb00p
[2020-04-14] phiresky/ripgrep-all: rga: ripgrep, but also search in PDFs, E-Books, Office documents, zip, tar.gz, etc.
[[Learn to remember things. Its super useful and saves lots of context switch]] [[memory]]
- [[maybe do dual n-back?]] [[nback]]
- [2018-07-07] actually, if I really try hard, I do seem to memorise. However I'd like it to be more passive
- [2019-07-30] eh, I think I'm fine. I haven't been annoyed at forgeting things since don't know when
[2020-10-07] Ceasar Bautista (@Ceasar_Bautista) / Twitter [[pkm]] [[social]]
[2020-05-16] Ask HN: Is there a search engine which excludes the world's biggest websites? [[search]]
[2020-05-25] Show HN: A Firefox add-on to strip Google search results of 'blacklisted' URLs
[[Tweet from @posobin show to lunachev?]]
[[Malleable Systems: Software must be as easy to change as it is to use it]]
[[setup gnome tracker?]] [[search]]
[2020-10-25] Xapian - Wikipedia [[outbox]]
[2020-10-25] FabriceColin/pinot: Personal search and metasearch for the Free Desktop [[search]] [[pkm]]
[2019-12-08] information queue? [[pkm]] [[search]] [[toblog]]
[2020-03-06] Using Anki to remember what you read
[[meh. fuck youtube playlists, I can't even comment on why videos are interesting]] [[pkm]]
[2020-01-25] Re: [koniu/recoll-webui] NOTE: A (Python 3) fork is actively maintained here (74)
[2020-01-30] dessant/web-archives: 📦 Browser extension for viewing archived and cached versions of web pages
[2020-05-12] Thinking Tools - Electric bicycles for the mind
- [2020-12-16] subscribe?
[[I need to stop caring so much about priorities. they change anyway and mean very little for other people]] [[org]] [[exobrain]]
[[need to display how deep is the item in agenda, otherwise hard to prioritize..]] [[org]]
[[pinborg pkm]] [[pkm]] [[ml]]
- [2019-02-06] read it a while ago, but should do again, now that I have my own tool
- [2019-07-23] huh, actually now I'm really thinking it makes sense lol
[2019-07-20] KnownSpace Links [[pkm]]
- [2019-08-13] dunno, everything looks pretty outdated
[2019-12-18] silo - IndieWeb [[toblog]] [[pkm]]
[[Figure out todo for gmail]]
- [2019-06-13] ugh. ifttt can't even create a custom
[2018-07-17] emacsomancer comments on So I just discovered org mode. Head = blown. [[org]] [[pkm]] [[annotation]]
[2019-12-22] datapuller
- [2019-12-24] I mean it's ok, but not as elaborate as mine..
[[evaluating feedbin to replace feedly]] [[rss]]
- [2019-04-27] till 2 May?
[[Tweet from Patrick Collison (@patrickc), at Jul 23, 16:40]]
[2018-11-12] MindForger - Thinking Notebook and Markdown IDE
- [[review it and compare with org-mode?]]
- [[add it to searchalert??]] [[axol]]
[[obstacles to more effecient PKM]] [[emacs]] [[pkm]] [[setup]] [[toblog]]
- [[next, search. my SPC S thing is pretty good already would be nice to have it available both in emacs and in shell. put in a config file, read it at emacs startup ok, they even share a config. nice]]
- [[use S for searching info in terminal]] [[habit]] [[pkm]]
  - [[recoll config, share it]] [[setup]]
- [next, indexing search. Use that plugin for indexing thing at home make sure I can easily tag match against all accessible org entries, would be nice to have agenda view for them ok, org-tags-view kinda do that? org-search-view! the only (possibly) annoying thing is everything has to contribute to agenda? so could set custom scope (with some cache?)](#nxtndxngsrchsthtplgnfrndxtgndscldstcstmscpwthsmcch TIDDLYLINK)
  - [[maybe I need something caching all agenda entries? cause it could e too slow…]]
  - [[automatic searches for interesting topics]] [[axol]]
[2019-12-23] Generate RSS feeds for any web page | PolitePol [[rss]]
- [2020-05-16] hmm, this is ought to be a bookmarklet?
[2019-12-20] hckr news - Hacker News sorted by time [[hackernews]]
[[Google search]] [[search]]
[2019-06-23] Resorting Media Ratings - Gwern.net
[[Tweet from Yoshiki 義樹 (@yoshikischmitz), at Dec 7, 02:13]] [[notion]]
[2019-11-21] Twitter analytics & stats for user @fortelabs | Social Bearing [[twitter]]
[[Google search]] [[search]] [[google]]
[[https://github.com/BurntSushi/ripgrep/issues/1497 indexing ripgrep]]
[[I want an extension to do this]] [[hackernews]] [[totweet]] [[pkm]]
[2020-05-31] media.ccc.de - The Advantages of File Name Conventions and Tagging [[towatch]] [[pkm]]
[[people working on PKM things with examples of products etc]] [[toblog]]
[2020-06-21] GTD Gmail: Inbox Zero and Optimized Email Workflow [[gtd]]
[2019-06-22] W3C Web Annotation Working Group [[pkm]] [[annotation]]
- [2019-06-27] https://twitter.com/mrgunn/status/1129033408628133888
- [2019-06-27] https://web.hypothes.is/blog/annotation-is-now-a-web-standard/
[2017-07-27] YSK: You can see deleted posts by replacing the "r" in "reddit" with a "c" in the URL. [[reddit]]
[2019-11-21] twitter - Find the most liked tweet from an account - Web Applications Stack Exchange [[twitter]]
[[A super clean organization system does not actually help us retain knowledge. Rather, such system requires so much maintenance effort that it subverts the very thing that it promises to do–help us learn–. I ended up expanding an exorbitant amount of time managing tags, keywords, and hierarchy of data that I may never even retrieve. All in all, organizing knowledge should never become the goal when building a personal knowledge base.]] [[pkm]] [[toblog]]
[[StorexHub is our offline-first API and plugin platform that allows you to work with Memex data outside of the browser. But it also works between different apps, making it a bit like an offline-first Zapier. You can query Memex data, listen to changes or write to its database.]] [[worldbrain]]
[[https://mobile.twitter.com/ankitmalik/status/1227636734478831618]] [[annotation]] [[gadget]]
[[When you run into a new YT channel, go through it on computer, add good videos to a separate playlist, then watch without hassle]] [[pkm]] [[habit]]
[[Fuzzy Anchoring – Hypothesis]] [[annotation]] [[hypothesis]]
[2019-07-04] Discovering Hypothes.is | Luis Puerto [[hypothesis]]
- [2019-10-10] Just an ok overview, I think I cover same if not more
[2019-07-06] Overview of the Hypothesis System : Overview of the Hypothesis System [[hypothesis]]
[2020-05-27] Subscribe Hypothesis annotations [[hypothesis]]
[2019-03-17] Building a Second Brain: Capturing, Organizing, and Sharing Knowledge Using Digital Notes - YouTube [[pkm]]
[2019-02-13] Designing a Personal Knowledgebase – A Curious Mix [[pkm]]
- [2019-04-13] ok, his system is not flexible enough for me, but somments are decent in terms of motivation and showing different approaches to pkm
[2019-12-04] I suppose it's more of a research assistant/references tool, so not exactly for me [[zotero]]
[2019-06-23] HighlightAll – Get this Extension for 🦊 Firefox (en-US) [[search]]
[2019-03-12] Tagging is Broken | Praxis [[pkm]]
[2020-07-01] Searchfox [[search]]
[2019-05-10] Internet Search Tips - Gwern.net [[pkm]] [[search]]
- [2019-06-13] ok, not so useful for me, but might be good to recommend to newbies
[2019-12-02] you will forget things [[exobrain]] [[motivation]]
[2019-01-17] https://treeverse.app/ tool to navigate twitter threads [[twitter]]
[2018-11-07] JacobEvelyn/friends: Spend time with the people you care about. Introvert-tested. Extrovert-approved. [[social]] [[pkm]]
[2020-01-30] Build the ultimate personal knowledge management system /r/productivity [[pkm]]
[2019-12-09] As We May Think (1945) [[pkm]]
[[Piotr Limanowski 🔥 Reading for Programmers]] [[productivity]] [[pkm]]
[2020-04-23] dbohdan/structured-text-tools: A list of command line tools for manipulating structured text data
[[kobo – can't highlight in pocket items…]] [[kobo]]
[[A Cosmology for a Different Computer Universe: Data Model, Mechanisms, Virtual Machine and Visualization Infrastructure | Nelson]] [[pkm]]
[2019-06-01] Capstone, a tablet for thinking [[inspiration]] [[pkm]]
- [2019-06-14] I guess it's not for me, too fuzzy.. but could be good for artists etc
[2019-06-30] Software I like: PDF readers and manipulators [[annotation]]
[2019-02-13] A Complete Guide to Tagging for Personal Knowledge Management | Praxis [[tagging]] [[pkm]]
- [2019-03-12] ok, nothing too enlightening I suppose
[2020-12-31] Personal Knowledge Management – The Fortune Labs [[toblog]] [[pkm]]
[2020-06-06] Why I take notes of everything I learn | Ramses' Blog [[pkm]] [[notes]]
[2019-02-11] Welcome! [[physics]] [[inspiration]] [[pkm]]
[2019-07-16] TagSpaces - Your versatile file manager [[pkm]] [[tagging]]
[2021-01-17] Zotero best practices - Knowledge management - Obsidian Forum
[2020-12-31] Luca Ongaro - MiniSearch, a client-side full-text search engine [[search]]
[2020-09-13] Web Clipper Browser Extension with Automatic Content Extraction, Now Open Source | Hacker News
[2020-04-01] You are my spirit animal. I just got a polar/readwise/orgmode/Anki setup togeth… | Hacker News [[remarkable]]
[2020-03-31] Kill the newsletter: Convert newsletters into RSS feeds | Hacker News [[rss]]
[2019-12-30] Hacker News RSS [[rss]] [[hackewnews]]
[2019-08-28] RomanPlusPlus/mindfilesResources: A collection of resources related to mindfiles (digital representations of your mind) [[github]] [[rss]]
[2019-12-03] How to annotate literally everything | beepb00p [[kobo]] [[annotation]]
[2019-04-19] inspiration: About – A Curious Mix [[qs]] [[pkm]]
[[using Reddit as search engine]] [[search]] [[reddit]] [[toblog]]
[[I'm interested in ways of fast processing of semistructured data like json (link to kython things?)]] [[toblog]] [[pkm]]
[[write about fmc?]] [[toblog]] [[pkm]]
[2019-12-02] Ask HN: How did you build up your personal knowledge base? | Hacker News
- [2019-12-03] arguments for forgetting?
[[Build the ultimate personal knowledge management system - productivity]]
[2020-01-30] Digital Tools I Wish Existed | Hacker News [[pkm]]
[[https://news.ycombinator.com/item?id=21653923]] [[pkm]] [[annotation]]
[[process .archive, but show them at the very end? similar with ignored files maybe?]] [[pkm]] [[search]]
[2020-12-28] https://github.com/jameslittle230/stork [[search]]
[[rename to 'my personal knowledge and information' setup? also how to cope with fleshy body and brain?]] [[pkm]] [[infra]] [[toblog]]
[2020-05-03] Don't Do Complex Folder Hierarchies - They Don't Work and This Is Why and What to Do Instead [[toblog]] [[tagging]]
[2020-05-01] (1) jestem króliczkiem on Twitter: "@cj_pais I've had this existential crisis with browser bookmarks few years ago, which made me switch to Pinboard" / Twitter [[toblog]] [[pkm]]
[2021-01-17] annotation-talks
[2021-01-25] Everything I Know – Wiki | Hacker News
[2021-01-20] RyanGreenup/cadmus: Shell Scripts to Facilitate Effective Note Taking [[pkm]]
[2019-12-30] The Zettelkasten Method - LessWrong 2.0 https://www.lesswrong.com/posts/NfdHG6oHBJ8Qxc26s/the-zettelkasten-method-1
[2019-07-06] Annotating Books! | Books & Writing Amino https://aminoapps.com/c/books/page/blog/annotating-books/oZid_uQnM4VY6XwzlqgmE8qNLENlEr
[2019-06-19] that's why we can't have nice PDFs : linux https://www.reddit.com/r/linux/comments/yr180/thats_why_we_cant_have_nice_pdfs/
[2020-01-05] What tools do you use to maintain a personal log/journal ? | Lobsters https://lobste.rs/s/peevtw/what_tools_do_you_use_maintain_personal
[2019-11-20] How to not use Google search - Shahinism https://shahinism.com/en/posts/alternative-to-google-search/ [[search]]
[2019-09-02] bryanph/GeistMap: A personal knowledge base/network with a focus on connections https://github.com/bryanph/GeistMap
[2020-05-07] returntocorp/semgrep: like grep but for code: fast and syntax-aware semantic code pattern search for many languages [[search]]
[2019-09-21] full-stack monastic 🧘‍♂️🗺 on Twitter: "tags are useful as a secondary organizational method, especially as the # of notes you have increases. don’t tag everything ahead of time. wait until you have many notes to process, then build structure. you can create custom tags specific to your profession or big projects. https://t.co/CtlOvTNDzm" / Twitter
[2021-01-03] Ask HN: What Do You Think? | Hacker News
[2020-05-11] Erik Allberg on Twitter: "As Erik's tweets get influence, I have to comment, with the risks of what is happening around networked text (Ex Roam, OrgRoam, OpenRoam, Athens, Dumbledore. ex. Live without 2nd brain? Risk @nntaleb Cult around Roam? Nah / Syntheism @Bardissimo Scenario:Dumbledore non-profit" / Twitter
[2021-01-29] Artificial Brain Networked notebook app
[2020-11-24] ice9 on Twitter: "@tentontintin It's even more ambiguous at this point, given the useless new 'BERT' NLP system used for generating results– it routinely ignores terms from the query, even ones with obvious semantic importance, so results are often entirely irrelevant to the complete requested term set." / Twitter [[google]] [[search]]
[[need "NEXT" todo entry? this would mean I need to actively act on something?]] [[pkm]]
[2021-04-29] soulisalmed/biff: Extract text and images from highlighted pdf generated with reMarkable tablet. [[pkm]] [[remarkable]]

`[2020-03-20]` Use phones to collect and triage, not (usually) to read

https://notes.andymatuschak.org/Use_phones_to_collect_and_triage%2C_not_(usually)_to_read

Use phones to collect and triage, not (usually) to read

Tweet from @jborichevskiy

https://twitter.com/jborichevskiy/status/1245559381560721408

@jborichevskiy: This is @RoamResearch in a nutshell. Not having to dig around for that note, that link, that whatever - allows things to flow with wonderful speed.

https://github.com/alphapapa/transclusion-in-emacs [[transclusion]] [[emacs]]

related [[learning]]

`[2018-11-09]` WorldBrain/Memex: Browser Extension to full-text search your browsing history & bookmarks. [[worldbrain]] [[annotation]] [[promnesia]]

https://github.com/WorldBrain/Memex

`[2019-03-23]` hmm, all data stored locally… wonder if could integrate with wereyouhere..

`[2020-05-06]` Memex Dreams ‒ Szymon Kaliski [[pkm]]

I stopped trusting my memory a long time ago, and I hate the feeling of stuff slipping through the cracks.

`[2021-01-04]` good description of the pkm process, probably similar to mine

personal knowledge management [[think]]

also need some search engine

fuzzy thing to launch MC in specific directory [[pkm]]

shit, sometimes it just doesn't annotate on the first invokation [[hypothesis]]

`[2019-05-05]` ugh… seriously, just open new link, click hypothesis button and hightlight. refresh the page; hightlight is gone :(

`[2019-12-17]` I think it's resolved??

`[2019-06-05]` The rise of Personal Knowledge Management tools

https://no-kill-switch.ghost.io/the-rise-of-personal-knowledge-management-tools

Yeah, maybe I'm not a typical person - but I collect, parse & use a lot of data, so I really need my stuff well organized.

`[2019-07-02]` read them more? https://no-kill-switch.ghost.io

`[2018-11-19]` Do you guys have a personal wiki? (using org-mode or not) /r/emacs [[exobrain]] [[org]]

I think Org transcends the idea of a wiki.  What is a wiki, anyway?  Documents with links to themselves.  Org does that and much more.
For myself, I keep information in several Org files.

* Information that doesn't change much, that I need to refer to now and then, that fits in a hierarchy, goes in `reference.org`.
* Things I come across randomly that I want to record for later (e.g. web pages, snippets, quotes) goes in `cpb.org` (for commonplace book) in a datetree; I can find it later with Org search tools, including `helm-org-rifle`.
* Appointments that are independent of other entries go in `calendar.org`.
* Stuff I need to refile goes in `inbox.org`, but I'm trying to get in the habit of putting things in `cpb.org` instead of putting them in a massive inbox file, thinking that I'll refile them later; I never do, so I might as well put them in a datetree, which at least organizes them chronologically rather than a giant, flat list.
  * This includes archived web pages, which I now capture with `org-web-tools-attach-url-archive`.  Sometimes I also capture the plain-text readable parts of web pages with `org-web-tools-read-url-as-org` or directly into a capture template with `org-web-tools--url-as-readable-org`.
* Most project and task stuff goes in `main.org`.
* Personal log/journal/diary-type entries go in `log.org`.
* Transient stuff goes in `temp.org` (which is excluded from the git repo I keep Org files in).
* Things I'm working on right now and want to keep in front of me (sort of like a sticky note on a monitor) go in `now.org`, which I access and manage with `org-now`.

Hope that helps!

Remember, Org is a platform for building your own system.  Take it easy, take your time, enjoy the ride.  Emacs and Org are software for the rest of your life.

eh maybe use some markdown-based organiser just for search? and reuse my exobrain script for export [[phone]] [[pkm]]

although I'm gonna need to disable html export bits then

`[2020-08-26]` markor?

I want to see a piece of information once, unless I explicitly want otherwise (i.e. spaced repetition) [[motivation]]

Just use roam style links? [[pkm]]

`[2020-05-15]` WorldBrain.io on Twitter: "So much good stuff in the upcoming Memex 2.1. ⭐️ Add all open tags to lists and tags via the sidebar ⭐️ 80% less resource usage ⭐️ Tons of performance improvements (no more fans from hell) ⭐️ More stability" / Twitter [[worldbrain]]

So much good stuff in the upcoming Memex 2.1.
 Add all open tags to lists and tags via the sidebar
 80% less resource usage
 Tons of performance improvements (no more fans from hell)
 More stability

`[2020-05-19]` WorldBrain's Memex: Bookmarking for the power users of the web | Hacker News [[worldbrain]]

I have been using Memex for more than a year now. Here are the things that really annoy me
- occasional freezing and sudden disappearance of your bookmarks
- no real way to programmatically access your Memex database. I know they have released the storage backend, but the lack of helpful documentation is a deal-breaker.
- lack of collaborative annotation (the way Hypothesis does)
- only few results in search results!

`[2020-05-11]` Vision, Mission & Values — 2020 Update - WorldBrain.io - Medium [[annotation]]

or translate the data into other data models, like the open annotation data model.

firefox saved searches via bookmarks actually get synced? [[pkm]] [[totweet]] [[toblog]]

`[2020-07-06]` right, so it seems to be exactly equivalent, and works without extensions

proper search with recoll could be useful when there are too many results? [[pkm]]

Perhaps most prominently, the creator of the SuperMemo system, Piotr Wozniak, has written extensively about the many ingenious ways he uses memory systems

How can we develop transformative tools for thought?
in context

Show HN: Fraidycat

Show HN: Fraidycat - https://news.ycombinator.com/item?id=22545878

`[2020-03-16]` Conor is Hiring for Roam (DMs open) Designers esp. on Twitter: "The Zettelkasten. "It's like the GTD for intellectual progress" What it is, and why you want one. (thread)" / Twitter [[pkm]]

https://twitter.com/Conaw/status/1129788853189955584

`[2020-07-26]` posobin/ampie: Social navigator for the web

`[2020-07-26]` Gleb Posobin on Twitter: "Published ampie for Firefox! https://t.co/e9pTwO8uuz History doesn't work as well as on Chrome yet though. Also published the extension's source code under the MIT license: https://t.co/VlBPKiH0QU https://t.co/mT2z3qHSJy" / Twitter

Published ampie for Firefox! https://addons.mozilla.org/en-US/firefox/addon/ampie/
History doesn't work as well as on Chrome yet though.
Also published the extension's source code under the MIT license: https://github.com/posobin/ampie

`[2020-08-21]` https://addons.mozilla.org/en-US/firefox/addon/ampie/ rate it

`[2017-11-01]` thoughts on my own todo app [[pkm]] [[think]]

Super important task are reminders

choose postpone length (in org?)

scheduling day: starts at 05:00, ends at 04:59. 05:00 I am most likely to sleep

postpone -> find next compatible slot

Neural network with pairs?

e.g. what conflicts with what?

to be honest, I should just check with calendar more often and it would all be fine

Might be overly conservative?

Examples:

You're going skiing to switzerland on wednesday. You bought new boots on Sunday and wore them all day. You might rub your feet so you might be unable to ski. Can we prevent it?

dentist

dentist appointment at 10 am. You are likely to get a filling which requires you not to eat or drink anything that might color it for 24 hours.
On the same day at 9pm you have a meeting with your friends at a pub. You like drinking Kriek, which definitely might color your teeth! Can we prevent such a conflict?

Internet Search Tips - Gwern.net

`[2019-06-13]` archiver-bot: automatically archive your web browsing and/or links from arbitrary websites to forestall linkrot; particularly useful for detecting & recovering from dead PDF links

`[2019-06-13]` Useful tools to know about: wget, cURL, HTTrack; Firefox plugins: NoScript, uBlock origin, Live HTTP Headers, Bypass Paywalls, cookie exporting. Short of downloading a website, it might also be useful to pre-emptively archive it by using linkchecker to crawl it, compile a list of all external & internal links, and store them for processing by another archival program (see Archiving URLs for examples).

Single file html [[linkrot]]

I gave up on the idea of reliably saving web pages in PDF.
I use now "SingleFile", a Firefox or Chrome extension that helps to save a complete page (with CSS, images, fonts, frames, etc.) as a single HTML file.
https://addons.mozilla.org/en-US/firefox/addon/single-file/
https://chrome.google.com/webstore/detail/singlefile/mpiodij...
https://github.com/gildas-lormeau/SingleFile

Tweet from Andy Matuschak (@andy_matuschak), at Dec 30, 03:23 [[pkm]]

There's a funny response curve: folks who are super-diligent about note-taking practices or building simulations seem to generally end up with less insight than their somewhat-less-diligent neighbors.
Maybe it's a explore/exploit thing? Or maybe just a wonk/gestalt thing?
https://twitter.com/andy_matuschak/status/1211487901386543106

https://github.com/WorldBrain/Memex-Mobile [[worldbrain]]

`[2020-03-17]` (1) Szymon Kaliski on Twitter: "📓 published muninn - set of cli tools, and vim plugin, for managing my personal flat-file markdown-based wiki, including @RoamResearch-like backlinks, todo management, minimal web ui, and more! https://t.co/Zg3RGjOcva" / Twitter

https://twitter.com/szymon_k/status/1229455411654340609

published muninn - set of cli tools, and vim plugin, for managing my personal flat-file markdown-based wiki, including @RoamResearch
-like backlinks, todo management, minimal web ui, and more!

`[2020-05-09]` Thinking by Writing ‒ Szymon Kaliski [[writing]]

https://szymonkaliski.com/notes/thinking-by-writing/

Honorable Mentions: Memex by Worldbrain.io, Roam Research, Notion, Coda.io, Alfred, Trove, Local Native, ArchiveBox, Raindrop

from ip Digital Tools I Wish Existed

`[2020-06-19]` Abdillah/hypothesis-firefox: Unofficial. Hypothes.is Firefox addon for annotating anywhere!

Tweet from @Conaw try foam?

https://twitter.com/Conaw/status/1283178647449333761

@Conaw: I love @tangjeff0 and @AthensResearch, love that @jethroksy and @jevakallio have taken Roam ideas into new ecosystems - bc those ecosystems now push new frontiers and build commons, like with this!

jborischevsky: https://news.ycombinator.com/item?id=21747852 [[pkm]] [[infra]]

Local cache would definitely be the (easiest) way of solving it. Tools like Memex [0] are most of the way there.
But a text-only copy on my local device isn't great if the content had special formatting in presentation. Also, it misses out on images or embedded videos. That's where something like ArchiveBox [1] comes in.
> ArchiveBox takes a list of website URLs you want to archive, and creates a local, static, browsable HTML clone of the content from those websites (it saves HTML, JS, media files, PDFs, images and more).
But really what I'd like to see at some point is an opt-in community tool where every page I visit that fits a certain criteria (URL, topic, special mark by me, etc) is fully cloned and uploaded to IPFS [2] for anyone interested in that topic to find and use later - regardless of what happens to the source content. Definitely a host of legal issues around this, but not impossible.

0 - https://worldbrain.io/
1 - https://github.com/pirate/ArchiveBox
2 - https://ipfs.io/

`[2019-12-05]` Profile: h0p3 | Hacker News [[pkm]] [[exobrain]] [[people]]

https://news.ycombinator.com/user?id=h0p3
huh, this guy uploads his mind onto wiki

Need a tool to match and highlight arbitrary text in pdf [[annotation]]

Pdfgrep? -n option prints page

`[2019-06-13]` I gues polar mostly works

Organize pdf, search for duplicates [[pkm]] [[polar]]

figure out a way to classify pdfs I have. I should mark them at the time of download, otherwise I forget [[pkm]] [[study]]

perhaps rely on file hashes/some sort of fingerprints (e.g. meta hash) ? that way I can mark it immediately
and track files in some tool

`[2019-02-10]` ok, maybe just make sure I always highlight interesting bits?

`[2019-06-13]` again, polar mostly ok

track all pdfs I ever had. in the simplest approach, just have a binding to archive it [[pkm]]

or, store the fingerprints

`[2019-06-13]` polar got pdfs

use zzzfoo for recoll (F2) [[pkm]] [[habit]]

https://github.com/andersju/zzzfoo

`[2019-06-13]` not sure about that… I guess rofi is not the most convenient interface after all… need something that doesn't go away easily, maybe some different window mode?

look up stuff in pinboard tags. also I need to export my org link collection to pinboard too [[pkm]]

I guess compute diff and approve each item

hmm, actually now I might be able to do that via porg?

tool to automatically explore a user for the tags I'm interested in? [[pinboard]] [[pkm]]

`[2019-07-30]` hmm, axol kinda does that… [[axol]]

two separate areas: structured notes and unstructured [[pkm]] [[think]]

https://hyp.is/RRB1jBTgEemGgbunD33LHQ/medium.com/the-personal-knowledge-management-saga/the-personal-knowledge-management-saga-part-1-ae9bdc575ded

`[2019-02-10]` figuring out if it's ok as pdf viewer [[polar]] [[pkm]]

it has some sort of fingerprint in the state.json too
so it handles moves and renames fine
cool, the filename is just unchanged, so it only uses the fingerprint
ok, can even tag in polar as well

minor ui issues (e.g. tagging)

would be nice to be able to tag via polar viewer

editing annotations

hmm .stash dir – can we get away without copying files? [[polar]]

would be cool to implement conversion into other hightlight formats and export

`[2019-01-17]` Deferential Geometry [[physics]] [[pkm]] [[wiki]] [[inspiration]]

http://deferentialgeometry.org
interesting wiki, very cool generally, but sad you can't easily jump to specific entries

would be interesting to regularly look for annotations on the same pages I have annotated [[pkm]]

https://www.reddit.com/r/orgmode/comments/3b9bib/orgmode_for_humanities_research_notes_similar_to/cskh6an/ [[org]] [[pkm]]

isearch, helm-swoop
interesting, i'm pretty much doing everything she mentions in the comment

`[2019-05-14]` ok, I could:

keep a permanent emacs instance
load all files via (find-file "*/.org"). perhaps run that by timer or something? maybe just use rg to get all targets, might be easiest
use helm-multi-swoop-all
make sure to load in fundamental mode

`[2019-07-27]` if I find that useful, implement proper timer for reloading new files regularly. Find a way to answer y to opening in fundamental mode?

`[2019-08-20]` ah right… it's sacha chua…

GitHub - matthewmueller/x-ray: The next web scraper. See through the noise.

https://github.com/matthewmueller/x-ray

hightlighting certain things on page based on whether it contains certain link? that way could simulate priorities anywhere [[pkm]] [[chrome]]

hmm do I need to clean old index? [[recoll]] [[pkm]]

search by org tags? [[pkm]] [[emacs]]

`[2019-04-13]` inspiration: renerocksai/sublime_zk

A SublimeText3 package featuring ID based wiki style links, and tags, intended for zettelkasten method users. Loaded with tons of features like inline image display, sophisticated tag search, note transclusion features, support for note templates, bibliography support, support for multiple panes, etc. to make working in your Zettelkasten a joy

`[2019-04-19]` Post-Evernote: How to Migrate Your Evernote Notes, Images and Tags into Plain Text Markdown - Minding the Borderlands [[pkm]]

http://www.markwk.com/migrate-evernote-plaintext.html

Designing better file organization around tags, not hierarchies [[pkm]] [[tagging]]

https://www.nayuki.io/page/designing-better-file-organization-around-tags-not-hierarchies

`[2019-05-05]` a lot of various tag-based filesystems etc

make views into reddit comments? multiple blocks; fetch them regularly? [[toblog]] [[pkm]]

`[2019-01-17]` Welcome! [[physics]] [[pkm]] [[inspiration]]

https://physicstravelguide.com/start

Add display for read only pdf annotations? [[polar]] [[annotating]]

Tweet from ¬¬(Dan Piponi) (@sigfpe), at Mar 6, 18:54 [[annotation]]

Liquid Text (@LiquidTextCorp) has a great feature allowing you to "scrunch" up pages of PDFs to quickly compare what you're reading with something earlier. (The correct way to do split screen IMO) I find myself trying to do this with web browsers now. It really is a nice feature.
https://twitter.com/sigfpe/status/1103368220314988545

`[2019-07-30]` split screen looks good

`[2019-07-20]` A very brief introduction to Personal Knowledge Management – Relatris Blog und Fundstücke [[toblog]]

https://blog.relatris.ch/2017/05/30/a-very-brief-introduction-to-personal-knowledge-management

`[2019-12-17]` pretty vague motivation

`[2019-06-20]` Open Semantic ETL toolkit for data integration, data analysis, document analysis, information extraction & data enrichment

https://opensemanticsearch.org/etl

Open Semantic ETL toolkit for data integration, data analysis, document analysis, information extraction & data enrichment
Open source frameworks for data integration, document processing, information extraction, data analysis, merging & combining data, content enrichment and data enrichment pipelines

recoll web: search as you type?? [[recoll]]

shit, couldn't figure out how to properly display with newline… [[recoll]] [[pkm]]

hmm, wonder how hard it'd be to build indexer [[search]] [[android]] [[pkm]] [[think]]

pdannots: failed to extract properly from Zee's book

`[2019-06-13]` Internet Search Tips - Gwern.net: Enable some kind of hotkey search with both prompt and copy-paste selection buffer, to turn searching Google (G)/Google Scholar (GS)/Wikipedia (WP) into a reflex.2 You should be able to search instinctively within a split second of becoming curious, with a few keystrokes. (If you can’t use it while IRCing without the other person noting your pauses, it’s not fast enough.)

use fmc in rofi?

`[2019-09-04]` howardyclo/Digestant: Modules for effectively digesting data from Twitter and Reddit using ML, NLP and statistics. [[pkm]] [[axol]]

https://github.com/howardyclo/Digestant

Modules for effectively digesting data from Twitter and Reddit using ML, NLP and statistics.

`[2019-08-25]` Org-brain /r/orgmode

`[2019-09-05]` Kungsgeten/org-brain: Org-mode wiki + concept-mapping

https://github.com/Kungsgeten/org-brain

Having multiple brains
You can have multiple brains simply by having more than one brain folder.

`[2019-09-05]` rofi-scripts/rofi-finder at master · davatorium/rofi-scripts

https://github.com/davatorium/rofi-scripts/tree/master/rofi-finder

rofi  -show find -modi find:~/.local/share/rofi/finder.sh

ugh. it blocked the UI while it was searching :(

`[2019-07-23]` neonion [[pkm]]

http://neonion.org
Semantic bit is kinda interesting

`[2019-08-09]` eh, looks like you need to import the document in it http://neonion.org/userdocs/index.html

`[2019-09-15]` also project hasn't been updated for a while

`[2019-09-28]` Orger: plaintext reflection of your digital self /r/orgmode

You may also be interested in GNU Hyperbole.

recoll: index downloads so it's easy to recall recent downloads? also nead to clean older indexed stuff [[pkm]]

Zeal [[search]]

Why Use Hyperbole (Use Cases)

https://www.gnu.org/software/hyperbole/HY-WHY.html

helm-ag would be useful to exclude file [[people]] [[pkm]]

think which of my workflows could be made available for more general public and how [[think]] [[pkm]]

`[2019-10-17]` NOTE: A (Python 3) fork is actively maintained here · Issue 74 · koniu/recoll-webui

https://github.com/koniu/recoll-webui/issues/74

NOTE: A (Python 3) fork is actively maintained here

`[2019-10-19]` Doug's 1968 Demo - Doug Engelbart Institute

http://www.dougengelbart.org/content/view/209/448

`[2019-10-31]` something similar to swoop for firefox would be nice. could implement in surfingkeys? [[think]] [[search]]

https://github.com/eli-oat [[people]] [[pkm]]

`[2019-11-06]` Brendan Schlagel on Twitter: "Petition to rebrand "personal knowledge management" > "personal librarianship" -broader remit (more to gain from reading than "knowledge") -sounds cooler & friendlier -could be a good theme / brand for https://t.co/Fd9MpAjnDj! (con: "personal librarian" has another meaning…)" / Twitter

https://twitter.com/schlagetown/status/1191814458957418497

Petition to rebrand "personal knowledge management" > "personal librarianship"

-broader remit (more to gain from reading than "knowledge")
-sounds cooler & friendlier
-could be a good theme / brand for http://antilibrari.es!

(con: "personal librarian" has another meaning…)

Ask HN: How do you organize document digests / personal knowledge? | Hacker News

https://news.ycombinator.com/item?id=21642289

Special account that favs my interesting tweets for a feed [[pkm]] [[search]] [[toblog]]

Run linkchecker against all links produced by me [[pkm]] [[promnesia]]

Tags for hn via nlp summaries? [[hackernews]]

Guy who thought about pkm issues [[pkm]]

I have thought about these issues a lot; especially lately. With regards to being able to scrape your data or just get your data back from 3rd party's, I think that's a losing battle. You need to be in control of your data before it gets to them. Web sites and APIs are constantly changing and sometimes just disappear. This idea of polling for changes seems very brittle and would never be up to date.

What I picture is an a program that you use to store your own microblogs, blogs, contacts, comments, etc. and then you publish to whoever from that app via their API or crawling.

Imagine you just created a new microblog entry. You can now either post to your Twitter, Mastodon, etc. accounts with the click of a button. You would have to poll for replies though and it would be up to you to store them if you wished (you probably want to if you are storing your replies). As an added benefit you could see the replies in one place instead of bouncing between two sites.

The point is, when you create the data, it's yours first. Then if you want to, you can post it other places. Tools like this are abundant for businesses, but we don't seem to build tools for actual people anymore.

Ask on HN how to read it so it's fair to everyone? [[outbox]] [[pkm]]

E.g. I'm going through show hn and ask hn
I have to vote without checking out sometimes, otherwise the link gets buried
Wish there were tags or smth similar to prioritize

find random python scripts around file system? [[pkm]]

What I wish I knew before joining Mastodon - By [[mastodon]] [[api]]

Mastodon, of course! #Mastodon is consistently the №1 hashtag people used, according to a Trendbot that tracks trending hashtags.

Managing my personal knowledge base | Hacker News

The API is supposed to be released soon. I intend to either build a backup workflow myself or use other tools that will get developed then.

`[2019-12-23]` perkeep/gphotos-cdp: This program uses the Chrome DevTools Protocol to drive a Chrome session that downloads your photos stored in Google Photos. [[pkm]]

https://github.com/perkeep/gphotos-cdp

This program uses the Chrome DevTools Protocol to drive a Chrome session that downloads your photos stored in Google Photos.

error handling would be nice to extract as well, e.g. error_helper… [[exports]]

Except with google it’s becoming impossible to find links from several years ago… | Hacker News

https://news.ycombinator.com/item?id=22107053

maybe I need some sort of 'seen' state for stuff in links.org [[pkm]]

or, only mark as todo when I've seen it. I guess makes more sense

might be nice to keep 'iteration' of how often I explored the link [[pkm]]

`[2020-02-12]` fuck, could actually integrate promnesia with emacs? that's be fucking insane. [[promnesia]]

need to treat tags and priorities as transient.. othewise too much friction [[pkm]]

Tweet from @blakeir

https://twitter.com/blakeir/status/1236086912659660800
@blakeir: Request for Startup:
A bookmark app that auto-triggers to save when I take a screenshot.
My phone’s camera roll is full of interesting sites, stories, tweets, Reddit posts, etc. that I always come back to.

`[2019-12-28]` Tips on using the Remembrance agent? : emacs [[pkm]]

https://www.reddit.com/r/emacs/comments/x2wue/tips_on_using_the_remembrance_agent/

Orgzly Workflow Showcase?

https://reddit.com/r/orgmode/comments/g06uu9/orgzly_workflow_showcase/fnbou8l?context=3

Tweet from @rektide

https://twitter.com/rektide/status/1246848335379652608

@rektide: @mpweiher @johnelliottDC your essay resonates a lot with me. i think the biggest most overwhelming thing for me is that it feels like software has gotten no more approachable.
folks like the @malleablesys seem like rare beacons in the dark, less interested in big bang of dev & more in adaptability.

the more I read news etc on PKM, the more it feels like I'm already on the cutting edge, know more than 99.99% of people about it and have collected all the low hanging fruit [[pkm]]

`[2019-11-28]` Profile: grblovrflowerrr | Hacker News [[people]] [[pkm]]

https://news.ycombinator.com/user?id=grblovrflowerrr

Thinking about humans, computers, and humans talking to computers.

`[2019-12-03]` https://news.ycombinator.com/threads?id=grblovrflowerrr

`[2019-12-03]` https://www.notion.so/Building-Blocks-For-The-Future-Of-Computing-7f74066de66749d59939a91ab13ec960

`[2019-11-28]` Yoshiki Schmitz

https://yschmitz.com

I'm a software developer that also tinkers in design. My goal is to create better tools for expressing and realizing ideas.

email/tweet at archive.org team about t.co links? [[hpi]] [[linkrot]]

`[2020-05-01]` Voice capture org-mode tasks on Android – Org mode Exocortex [[org]] [[dictation]]

`[2020-01-16]` axa-group/Parsr: Transforms PDF, Documents and Images into Enriched Structured Data

https://github.com/axa-group/Parsr
I guess could use it for some pdf extraction?

`[2019-07-06]` public voit - Homepage of Karl Voit [[german]] [[pkm]]

https://karl-voit.at/

`[2019-07-06]` git: post-commit hook for determining large number of deleted lines in Org-mode (paranoid) [[git]] [[setup]]

https://karl-voit.at/2014/08/20/org-losses-determining-post-commit/

`[2019-07-06]` My Personal Emacs History

https://karl-voit.at/2017/06/03/emacs-history/

My passion for PIM and the quest for the best PIM tools and methods out there resulted in a pretty advanced setup I've got. Meanwhile, I do almost anything within Emacs and Org-mode: todos, errands, project management, calendar/agenda, contact management, reference management, bookmark collection, knowledge base management, blogging, doing spreadsheet, presentations, quantified self, managing files such as photographs, accessing all kinds of data about me, and many more.

`[2019-07-06]` The Perfect Tool to Organize Your Digital Life (Emacs Org mode)

https://karl-voit.at/2018/12/28/35c3-orgmode/

`[2019-07-06]` Evolutional Steps of Computer Systems

https://karl-voit.at/2017/02/10/evolution-of-systems/

`[2019-07-06]` The Tag «decentralization»

https://karl-voit.at/tags/decentralization/

In my opinion, federated or decentralized systems are much stronger and prone to surveillance.

`[2019-07-06]` Going Back to Analog

https://karl-voit.at/2017/05/16/going-analog/

 This can be interpreted as a new era of Biedermeier, a new kind of Digital Cocooning.

I, personally, try to come up with a digital solution which includes avoiding the cloud and promoting decentralization and DIY solutions which are using open source software and open protocols.

`[2019-07-06]` Karl Voit (@n0v0id) | Twitter

https://twitter.com/n0v0id/

`[2019-07-06]` About

https://karl-voit.at/about/

`[2019-07-06]` My Dependencies on the Cloud

https://karl-voit.at/cloud-dependencies/

`[2019-07-06]` You Can't Control Your Data in the Cloud

https://karl-voit.at/cloud/

`[2019-09-26]` Venkatesh Rao on Twitter: "1/ There are some interesting lessons in the failure of bookmarking as a category" / Twitter

https://twitter.com/vgr/status/738449044742115328

1/ There are some interesting lessons in the failure of bookmarking as a category

`[2019-10-17]` jethrokuan/braindump: knowledge repository managed with org-mode and deft.

https://github.com/jethrokuan/braindump/

knowledge repository managed with org-mode and deft. https://braindump.jethro.dev/

share feedbin subscriptions? [[self]] [[rss]]

`[2020-05-13]` TreeSheets

A "hierarchical spreadsheet" that is a great replacement for spreadsheets, mind mappers, outliners, PIMs, text editors and small databases.

Tweet from @kwharrison13

https://twitter.com/kwharrison13/status/1275117874911211523

@kwharrison13: @L1AD @deeeepka @azeem @RoamResearch @Conaw I use it as a personal CRM and it’s never been better because I can have people in context with my thoughts. As I’m reading an article I can just tag their name in a note I take and next time I’m on a call with them I have those in my side bar as talking points.

https://github.com/Overdr0ne/sfs (search file system)

sfs-recoll

`[2020-06-13]` New Discord PKM community /r/Zettelkasten

Hey folks there's a server for knowledge management, the idea is for it to be tool agnostic and to help the different communities exchange workflows and ideas. Check it out:

https://discord.gg/3WY3ZqN

`[2020-01-30]` (1) Ildar Karimov on Twitter: "@artem_zin @karlicoss Google desktop app was able to inject a lot of local/private data into search results but discontinued in 2011 :(" / Twitter

https://twitter.com/the_very/status/1223022048945016832

Google desktop app was able to inject a lot of local/private data into search results but discontinued in 2011 :(

`[2020-03-20]` "🌞New Video: Combining Note-Taking and Spaced Repetition (SR) I talked about: 1. Integrating SR questions in permanent notes 2. adding SR questions while journaling 3. learning new words and phrases 4. using quick capture for SR https://t.co/OIvzV36bU5 https://t.co/iX1ZAzEcMs" / Twitter

https://twitter.com/ShuOmi3/status/1240985230229430272

New Video:
Combining Note-Taking and Spaced Repetition (SR)
I talked about:
1. Integrating SR questions in permanent notes
2. adding SR questions while journaling
3. learning new words and phrases
4. using quick capture for SR

`[2020-06-11]` OpenAI API [[pkm]]

The API allows for parsing text into spreadsheet tables, summarizing email discussions, expanding content from bullet points, and more.

`[2020-07-01]` Dan Girshovich - Zettelkasten [[pkm]]

Tweet from @mekarpeles

https://twitter.com/mekarpeles/status/1281494830372335619

@mekarpeles: Write things down. Leave notes. Make checklists. Review periodically. Keep logs. Record everything. Make backups. Keep a Zettelkasten. Use a memex. Date & tag documents. Connect and map like ideas. Keep a central index. Decentralize. Make things content addressable.

`[2020-08-24]` My takeaway from the recent trend in articles talking about how great the Zettel… | Hacker News

My takeaway from the recent trend in articles talking about how great the Zettelkasten method is:

Document what you do, as if you were describing your work and/or learning to a stranger. That stranger is you, in 6 months to 5 years time.

example/demo: enabling properties export for my blog [[elisp]] [[toblog]]

found that answer in google
https://emacs.stackexchange.com/questions/7607/export-properties-blocks-with-org-mode

suggests looking at org-export-with-properties

ok, SPC j v org-export-with-properties

ends up at ox.el

select org-export-with-properties and SPC RET for swoop 1

swoop through, nothing

SPC s d for directory search

aha! ox-publish.el

and finally swoop to org-export–skip-p in ox.el
so apparently it sets property-drawer and calls something else with the context?
SPC s d – aha, bunch of files including ox-html!

(property-drawer . org-html-property-drawer)

and we finally found the guilty party

(defun org-html-property-drawer (_property-drawer contents _info)
"Transcode a PROPERTY-DRAWER element from Org to HTML.
CONTENTS holds the contents of the drawer. INFO is a plist
holding contextual information."
(and (org-string-nw-p contents)
(format "<pre class=\"example\">\n%s" contents)))

alraban/org-recoll: A lightweight emacs org-mode wrapper for the recoll full-text search engine

https://github.com/alraban/org-recoll

Group hn posts to figure out what to filter? Not sure.. [[pkm]] [[hackernews]]

motivation for searching over my own posts: quick plaintext interface that works offline [[motivation]] [[pkm]]

in your tweets/toots etc there are prompts for longer materials form discussions with other people

`[2020-03-09]` Pinboard: Bookmark Detail

https://pinboard.in/u:greenireland/b:fe3b28f85645

A Complete Guide to Tagging for Personal Knowledge Management

`[2020-03-09]` Pinboard: Bookmark Detail

https://pinboard.in/u:nhaliday/b:5a4a0ef4c347

Ask HN: Favorite note-taking software? | Hacker News

`[2020-03-09]` Pinboard: Bookmark Detail

https://pinboard.in/u:gnf00x/b:5fa11ae78c6b

Knowledge Management
km
28 days ago by gnf00x  copy to mine

`[2020-03-09]` Pinboard: Bookmark Detail

https://pinboard.in/u:gnf00x/b:50bdb59f7dbe

Knowledge Management Systems: The Ultimate Guide
km
4 weeks ago by gnf00x  copy to mine

`[2020-03-10]` Mesh on Twitter: "@Conaw hell to the yes. Roam is so powerful it needs to be at the OS level and maybe beyond. 🤖 I saw mercury OS and immediately thought of Roam, it just intuitively fit. https://t.co/84MtykKJLu" / Twitter

https://twitter.com/meshachthomas/status/1237247575650004994

hell to the yes. Roam is so powerful it needs to be at the OS level and maybe beyond.
Robot face
I saw mercury OS and immediately thought of Roam, it just intuitively fit.

wonder if for me this roam thing could be replaced with 'virtual pages', based on properties? [[pkm]] [[roam]]

then you build a graph based on the property. your notes aren't scattered across the filesystem that way
now and then you can overview the notes based on this property and merge them if necessary
or maybe it's a thing enclosed in {}? but then it's tricky to process by org-mode
org maybe [] anchor?

search in images with ripgrep-all (rga) [[setup]] [[pkm]]

rga ipa . --rga-adapters=+pdfpages,tesseract -g '*.jpg'

could add a ripgrep config for image type??

`[2020-04-11]` David Laing on Twitter: "I'm stunned by @andy_matuschak's notes at https://t.co/DBxJzZrS2q—both their content and their form. I'm taking inspiration for my own site. I know almost nothing about web development, but yesterday I figured out how to make previews for internal links. Next up, backlinks! https://t.co/dNeJDOoKBG" / Twitter

https://twitter.com/davidklaing/status/1248886149625438208

I'm stunned by @andy_matuschak
's notes at https://notes.andymatuschak.org—both their content and their form.

I'm taking inspiration for my own site. I know almost nothing about web development, but yesterday I figured out how to make previews for internal links. Next up, backlinks!

`[2020-04-13]` The Curse of Xanadu: the longest-running vaporware in computing (1995) | Lobsters [[xanadu]]

enkiv2 avatar enkiv2 2 hours ago | link |

I am. I worked on the version covered in this article, and also on the previous release. Since 2014, another (totally independent) web-based version has been released.

wow that's fascinating

Nototo is a spatial note-taking app. It lets you build an ever-expanding, topographical map containing your notes and writing. The app is designed this way to take advantage of another aspect of spatial interfaces: our brains remember spaces better than raw information. In this regard, Nototo is like a software manifestation of a memory palace.

Spatial Software
in context

blocking site from search [[search]]

This used to be built-in to google itself. You could choose to block a site from future results from any results page. But they killed it, along with forum search, code search, usenet search, and so many other useful things.

`[2020-07-03]` america hater sarahzrf on Twitter: "god damn its nice to be able to just type a few keywords from a title into zotero's search instead of having to remember what shitty filename i saved something under" / Twitter

god damn its nice to be able to just type a few keywords from a title into zotero's search instead of having to remember what shitty filename i saved something under

Tweet from @andy_matuschak https://twitter.com/andy_matuschak/status/1278498290296745984

@andy_matuschak: Some people collect stamps; I’ve been collecting unusual applications of spaced repetition systems.
I realized today that I haven’t yet solicited the power of Twitter here! What weird use cases have you found?
My running list: notes.andymatuschak.org/zrs5Gn...

Tweet from @cj_pais

https://twitter.com/cj_pais/status/1280315415491559424
@cj_pais: Some initial ideas for 'feeds' I will be generating
stream.cjpais.com/feeds.html
I'm thinking that these 'deeper'/semantic feeds will provide insight, especially in a collaborative environment

blog – move to phone (after reinstall?) [[pkm]]

archived stuff – use .ignore file? [[pkm]]

This is my personal human computer interaction interface https://github.com/codygman/hci [[search]]

have symlinks to files in my knowledge from the repositories? e.g. promnesia/hpi. allow following symlinks for certain types? [[pkm]]

`[2020-08-26]` logseq (@logseq) / Twitter [[pkm]] [[exobrain]]

right, def need to try it out, seems it has publishing or something?

Tweet from Nat Eliason (@nateliason), at Jan 9, 07:21

Alright, it's alive!
3,000+ words on @RoamResearch, including why it's better than Evernote / Notion, and how I'm using it.
https://t.co/FGkbjf51On
TOC includes:
1. Why Roam?
3. Roam as a Second Brain
4. Roam for Productivity
5. Limitations
6. Getting Started
cc @Conaw

https://twitter.com/nateliason/status/1214943106581385216

`[2019-05-10]` Markor v1.8 - All new file browser, favourites and faster Markdown preview /r/fossdroid

go through all the ANN documents, wonder if any annotations are inside… [[pkm]]

maybe instead of PKM use KM? the shorter it is the easier it is maybe? [[pkm]]

`[2019-05-21]` Keeping Found Things Found: The Book | Keeping Found Things Found [[pkm]]

http://www.keepingfoundthingsfound.com/book

`[2019-07-27]` Tweet from Andy Matuschak (@andy_matuschak), at Jul 27, 01:00 [[pkm]]

@nicknikolov @marcinignac @context_ing Yes, they get modified in-place. I run the backlinks janitor at night. I also have this little bot, which I've published: https://t.co/mOy7RIsnn9
https://twitter.com/andy_matuschak/status/1154904280853204992

`[2019-11-21]` Samuel Breese [[pkm]]

https://chame.co

Most of my personal data is managed using the excellent git-annex.

comments duplicate.. [[polar]]

Tweet from Tiago Forte (@fortelabs), at Aug 26, 04:03 How to read non-fiction books [[reading]]

How to read non-fiction books:
1. Read first 30%
2. Stop & save highlights to a digital notes app
3. Add summary of how/when you think this material would be most useful
4. Search these notes next time you start a project
5. Finish reading books most likely to be useful

https://twitter.com/fortelabs/status/1165822145550663680

`[2019-01-17]` RaRe-Technologies/gensim: Topic Modelling for Humans [[nlp]] [[infextraction]]

https://github.com/RaRe-Technologies/gensim

`[2019-06-20]` Download | Open Semantic Search

https://www.opensemanticsearch.org/download/

Open Semantic Desktop Search is the all in one package for desktop users as virtual machine image configured for search on your own desktop computer or laptop running on Linux, Windows or iOS for Mac.

`[2019-07-23]` https://www.opensemanticsearch.org/doc/datamanagement/annotation

so, it integrates with Hypothesis? https://www.opensemanticsearch.org/doc/datamanagement/annotation/hypothesis

`[2019-07-23]` looks a bit manual otherwise though

`[2019-07-23]` not many results on pinboard

pkm python package for quickly adding things to my todo list? [[pkm]]

`[2019-02-06]` a python my.todos.add function would be cool

not sure, maybe appending entries is ok?…

actually pinboard could be used as org export… or sync one tag from org to pinboard tag? [[pinboard]] [[pkm]] [[org]]

Generate from backup

diagram of my tasks dependencies (also completed ones?) [[pkm]]

`[2019-05-19]` modifying reading stats (number of books read and hours read)? - MobileRead Forums

https://www.mobileread.com/forums/showthread.php?t=212875

For events 1, 36, 52 and 79 there seem to be only one row.

There are some inconsistencies. Both events 46 and 80 count page turns, but they don't match. The count for 80 is always less than for 46. It is possible that 46 is counting screens and 80 page numbers. The value for 46 is what is on the stats screen for the current book.

When I have looked at ExtraData, it tends to be made up of a series of timestamps. I suspect that for events like 1020 and 1021, it is a list of the times when the event occurred. The pairs from the two events might be used to calculate the minutes per session and hours read. The only problem with that, is that the counts don't match for the book I am currently reading. I am confident of the meaning of the events, but there seems to be occasions when the close is not recorded.

`[2019-05-16]` New tool: KM for digital collections/structured data /r/knowledgemanagement

Hi everyone,
I wanted to share a new knowledge management tool called [Gist](https://www.gistapp.com), for exploring data visually and adding context to digital collections.
Full disclosure—I'm the founder. Gist is a spin-off from [Schema](https://www.schemadesign.com), a data visualization design firm based in Seattle. I'd be interested to hear your thoughts on the tool—whether you think it would be useful, and how you would best describe it. Since it spans so many usecases, from KM for internal teams to "memory organizations" (museums, libraries, archives) and research organizations, finding a way to describe it to all audiences has been an interesting challenge.
I'd be curious to hear your thoughts. Thanks!

`[2019-05-16]` Org-mode Hidden Gems - 03 Hyperlinks /r/orgmode

`[2019-06-13]` Juan Campa on Twitter: "Dataspace is a fascinating concept by @natecull, reminds me a bit of @urbit and of course Membrane. https://t.co/SNXwAeA46a… https://t.co/4gEnZHUO2K"

https://twitter.com/juancampa/status/1030555210517815296

Dataspace is a fascinating concept by @natecull, reminds me a bit of @urbit and of course Membrane.

`[2019-06-22]` HowTo: Building Personal Index for Data Discovery - Virtuoso Universal Server / Tips, Tricks, and HowTos - OpenLink Software Community

https://community.openlinksw.com/t/howto-building-personal-index-for-data-discovery/900
huh… found in KM tag

`[2019-04-05]` zadam/trilium: Build your personal knowledge base with Trilium Notes [[pkm]]

https://github.com/zadam/trilium

`[2019-06-13]` erm, I guess it's not plaintext…

`[2019-06-27]` Non-fiction books: a waste of time? o_O

https://no-kill-switch.ghost.io/non-fiction-books-a-waste-of-time/

I make highlights & put bookmarks (using Kindle's built-in functionality, integrated with Goodreads) EVERY TIME I find something thought-provoking

`[2019-09-05]` Using Org-Brain

http://www.bobnewell.net/publish/35years/orgbrain.html

Links are at times illogical
Naming conventions can be confusing
It’s a lot more work to create a knowledge representation with this tool than with a graphics-based tool (such as, say, Cmap Tools)
You can only visualize part of the representation at a time
Documentation is sketchy and sometimes misleading
I don’t think it scales well to very large maps and multiple maps
You’ll have to experiment a lot to get the hang of it

`[2019-11-01]` Youtoofy

https://www.youtoofy.com

https://github.com/dvorka/mindforger

RSS it not really helpful; doesn't show diff… [[github]] [[pkm]] [[rss]]

`[2020-03-24]` Metaformat · GitBook

https://book.mindey.com/metaformat/0001-metaform-philosophy/0001-metaform-philosophy.html

Tweet from @Conaw Aspirations and inspirations thread https://t.co/YrwBJiP6dk

https://twitter.com/Conaw/status/1209412548736385025

Tweet from @round [[axol]]

https://twitter.com/round/status/1240043788078211072
@round: 🐦🔗🔍 Twitter Links Extension beta update:
More UI improvements including the ability to switch between ‘Latest’ and ‘Top’ tweets. Also tested to work perfectly on @MicrosoftEdge.
Go ahead give it a spin and and send me your feedback!

https://t.co/btoBlnqk4e https://t.co/pEyI7N5EhY

https://github.com/houshuang/Treeverse [[twitter]] [[pkm]]

`[2019-08-06]` Visakan Veerasamy on Twitter: "I usually talk about this in the context of personal knowledge management, about fun things like keeping track of quotes and riffs and blogpost ideas. Usually this is about me helping other (usually younger) scatterbrained people https://t.co/uPoy7Qw00j" / Twitter

https://twitter.com/visakanv/status/1157630882879926272

I usually talk about this in the context of personal knowledge management, about fun things like keeping track of quotes and riffs and blogpost ideas. Usually this is about me helping other (usually younger) scatterbrained people

`[2019-09-20]` vimoutliner/vimoutliner: Work fast, think well.

https://github.com/vimoutliner/vimoutliner

`[2019-11-17]` WICG/ScrollToTextFragment: Proposal to allow specifying a text snippet in a URL fragment

https://github.com/WICG/ScrollToTextFragment

ugh, massive duplication in неореакция-конспирология. wtf??? [[infra]] [[vk]]

e.g. search by 'whatsapp'

Archived tag – prefix with underscore? [[org]]

Tweet from @Conaw [[pkm]] [[memory]]

https://twitter.com/Conaw/status/1230685750837923840

@Conaw: Can't think of a better Hollywood clip to represent @RoamResearch and my life
"Don't you remember?"
"I wrote it down in my diary so I wouldn't HAVE TO REMEMBER"
But then, more importantly - what the grail quest is actually about - and what relationships w people on them is like twitter.com/ultimape/status/11...

Tweet from @RoamBrain

https://twitter.com/RoamBrain/status/1232026686499090432

@RoamBrain: The RoamBrain website has just launched. It is an independent information and resource hub for @RoamResearch serving both people new to Roam and more advanced users. RoamCult RoamBrain.com

`[2020-03-09]` Pinboard: Bookmark Detail

https://pinboard.in/u:nicknikolov/b:56c8b251c429

space and times
pkm

`[2020-03-13]` tool for Twitter Timeline Search. Analytics & filters for Twitter Accounts [[twitter]]

https://socialbearing.com/search/user
explore accounts; find best tweets

right, urls separated by commas… not ideal? [[twint]]

http://archive.org,https://github.com/pirate/ArchiveBox

`[2020-04-26]` How to annotate literally everything | beepb00p

Nice work! However it is possible to search through annotations using emacs pdf-tools, actually the search and filter functions are quite powerful in the annotation tablist, but you need to show contents first in the tablist buffer by customizing the pdf-annot-list-format variable (more info is found in issue 553: https://github.com/politza/pdf-tools/issues/553). The annotation tablist functionality is more or less only documented in its major-mode info. The code for the search function posted in that issue works nice also (actually it works better than searching via the tablist because there is a bug in the tablist search as mentioned in the comments of that issue).

Additionally I read that you don't like to use the mouse to add annotations. With the code in the pdf-avy-highlight.el file in this repository: https://github.com/dalanicolai/dala-emacs-lisp it is possible to highlight text and add comments (if you set to open them automatically by toggling the Pdf Annot Activate Created Annotations to "on" in the pdf-annot group in the customization menu) with only the keyboard using avy. You should should add your own shortcut for it (the one in the file is for use in Spacemacs). Unfortunately it does not work more conveniently than using the mouse. But I just like to point out the possibilities and versatility of emacs and pdf-tools...

`[2020-04-14]` phiresky/ripgrep-all: rga: ripgrep, but also search in PDFs, E-Books, Office documents, zip, tar.gz, etc.

Learn to remember things. Its super useful and saves lots of context switch [[memory]]

maybe do dual n-back? [[nback]]

`[2018-07-07]` actually, if I really try hard, I do seem to memorise. However I'd like it to be more passive

`[2019-07-30]` eh, I think I'm fine. I haven't been annoyed at forgeting things since don't know when

`[2020-10-07]` Ceasar Bautista (@Ceasar_Bautista) / Twitter [[pkm]] [[social]]

I've been writing my own encyclopedia at http://memex.cc for 7 years. Read a lot of tech, econ, science, philosophy. Sharing the things that surprise me here.

`[2020-05-16]` Ask HN: Is there a search engine which excludes the world's biggest websites? [[search]]

https://news.ycombinator.com/item?id=23202850

`[2020-05-25]` Show HN: A Firefox add-on to strip Google search results of 'blacklisted' URLs

https://github.com/davidahmed/wiper

Tweet from @posobin show to lunachev?

https://twitter.com/posobin/status/1318696146508877834

@posobin: 1. Go to a web page.
2. Amplify it.
3. When people that follow you on ampie google for a relevant query, they will get that page on the right side of the google results. https://t.co/s7KuQP888G

Malleable Systems: Software must be as easy to change as it is to use it

Malleable Systems: Software must be as easy to change as it is to use it - https://news.ycombinator.com/item?id=22857551

setup gnome tracker? [[search]]

`[2020-10-25]` Xapian - Wikipedia [[outbox]]

post about desktop search engines?

`[2020-10-25]` FabriceColin/pinot: Personal search and metasearch for the Free Desktop [[search]] [[pkm]]

eh, it's very simplistic..

`[2019-12-08]` information queue? [[pkm]] [[search]] [[toblog]]

`[2020-03-06]` Using Anki to remember what you read

https://superorganizers.substack.com/p/how-to-build-a-learning-machine###

meh. fuck youtube playlists, I can't even comment on why videos are interesting [[pkm]]

manage playlists in exobrain
sync playlists with youtube
in each playlists description add a link to exobrain playlist

`[2020-01-25]` Re: [koniu/recoll-webui] NOTE: A (Python 3) fork is actively maintained here (74)

[koniu/recoll-webui] NOTE: A (Python 3) fork is actively maintained here

`[2020-01-30]` dessant/web-archives: 📦 Browser extension for viewing archived and cached versions of web pages

https://github.com/dessant/web-archives

package Browser extension for viewing archived and cached versions of web pages

`[2020-05-12]` Thinking Tools - Electric bicycles for the mind

`[2020-12-16]` subscribe?

I need to stop caring so much about priorities. they change anyway and mean very little for other people [[org]] [[exobrain]]

need to display how deep is the item in agenda, otherwise hard to prioritize.. [[org]]

pinborg pkm [[pkm]] [[ml]]

http://www.drbunsen.org/pinborg
Ok pretty cool, but I think it's a bit too elaborate for me

`[2019-02-06]` read it a while ago, but should do again, now that I have my own tool

`[2019-07-23]` huh, actually now I'm really thinking it makes sense lol

`[2019-07-20]` KnownSpace Links [[pkm]]

http://www.roxie.org/knownspacelinks.html

Today's desktops are two decades old. They were hot biscuits then, but stale and crumbly---and moldy---bread today.

`[2019-08-13]` dunno, everything looks pretty outdated

`[2019-12-18]` silo - IndieWeb [[toblog]] [[pkm]]

https://indieweb.org/silo

Figure out todo for gmail

`[2019-06-13]` ugh. ifttt can't even create a custom

`[2018-07-17]` emacsomancer comments on So I just discovered org mode. Head = blown. [[org]] [[pkm]] [[annotation]]

https://www.reddit.com/r/orgmode/comments/8vav52/so_i_just_discovered_org_mode_head_blown/e1mtayb/
interleave, org-noter

`[2019-12-22]` datapuller

https://news.ycombinator.com/item?id=21844105

austil 1 day ago [-]
Hey, I'm on this journey too ! https://github.com/austil/datapuller

`[2019-12-24]` I mean it's ok, but not as elaborate as mine..

evaluating feedbin to replace feedly [[rss]]

State "STRT" from "TODO" [2019-04-17]

`[2019-04-27]` till 2 May?

Tweet from Patrick Collison (@patrickc), at Jul 23, 16:40

Is there a good @Pocket / @Instapaper alternative that reliably stores content for offline reading and handles PDFs properly? (Not sure about Instapaper, but Pocket only manages to render saved content ~70% of the time.)

https://twitter.com/patrickc/status/1153691264983764996

`[2018-11-12]` MindForger - Thinking Notebook and Markdown IDE

https://www.mindforger.com/

review it and compare with org-mode?

add it to searchalert?? [[axol]]

obstacles to more effecient PKM [[emacs]] [[pkm]] [[setup]] [[toblog]]

next, search. my SPC S thing is pretty good already would be nice to have it available both in emacs and in shell. put in a config file, read it at emacs startup ok, they even share a config. nice

use S for searching info in terminal [[habit]] [[pkm]]

recoll config, share it [[setup]]

next, indexing search. Use that plugin for indexing thing at home make sure I can easily tag match against all accessible org entries, would be nice to have agenda view for them ok, org-tags-view kinda do that? org-search-view! the only (possibly) annoying thing is everything has to contribute to agenda? so could set custom scope (with some cache?)

maybe I need something caching all agenda entries? cause it could e too slow…

automatic searches for interesting topics [[axol]]

`[2019-12-23]` Generate RSS feeds for any web page | PolitePol [[rss]]

https://politepol.com/en
https://github.com/taroved/pol

`[2020-05-16]` hmm, this is ought to be a bookmarklet?

`[2019-12-20]` hckr news - Hacker News sorted by time [[hackernews]]

https://hckrnews.com

Google search [[search]]

I've been prefixing all my searches with reddit and then filtering by within last month or last year, and something seems to have changed lately. The reddit results say some number of days within the time constraint, but then the result is actually years old which makes it all pointless. This is literally the only way I search google right now because their results are so spammy otherwise.

`[2019-06-23]` Resorting Media Ratings - Gwern.net

https://www.gwern.net/Resorter

huh, this is somewhat similar to what I was doing with IMDB?

Tweet from Yoshiki 義樹 (@yoshikischmitz), at Dec 7, 02:13 [[notion]]

But it was definitely enlightening to me just how important the browsing(reading?) experience is to a knowledge-base, perhaps more than the writing experience. It's definitely the first thing I'll evaluate in future apps,  and something I'll think about how it can be done better.

https://twitter.com/yoshikischmitz/status/1203135482655232000

`[2019-11-21]` Twitter analytics & stats for user @fortelabs | Social Bearing [[twitter]]

https://socialbearing.com/search/user/fortelabs
cool thing, might be good to overview accounts

Google search [[search]] [[google]]

I miss the days when I could search with AND, OR, +word and -word. Now if I search google with more than one word it no longer searches the internet. Instead it searches for ads that are somewhat similar to my query and features those. Any useful links on the first page are accidental.

https://github.com/BurntSushi/ripgrep/issues/1497 indexing ripgrep

I want an extension to do this [[hackernews]] [[totweet]] [[pkm]]

flag all news sites (and medium)
anyone knows of something like it?

for (const z of $x("//a[@class='storylink']")) {
    const u = new URL(z.href)
    const host = u.hostname.replace('www.', '');
    const bad = new Set(['medium.com', 'bbc.co.uk', 'theregister.co.uk', 'techcrunch.com', 'reuters.com', 'uk.reuters.com', 'bbc.com', 'nytimes.com', 'theguardian.com', 'bloomberg.com', 'gizmodo.com', 'washingtonpost.com', 'theatlantic.com', 'buzzfeednews.com', 'theverge.com', 'npr.org', 'vox.com', 'mashable.com', 'edition.cnn.com', 'wsj.com', 'cnn.com', 'independent.co.uk', 'onezero.medium.com']).has(host)
    console.log(z)
    if (bad) { z.style.color = '#ff000044'; z.nextSibling.children[0].style.color = '#ff000044' } else {    console.log(host); }
}

`[2020-05-31]` media.ccc.de - The Advantages of File Name Conventions and Tagging [[towatch]] [[pkm]]

people working on PKM things with examples of products etc [[toblog]]

`[2020-06-21]` GTD Gmail: Inbox Zero and Optimized Email Workflow [[gtd]]

`[2019-06-22]` W3C Web Annotation Working Group [[pkm]] [[annotation]]

https://www.w3.org/annotation/

`[2019-06-27]` https://twitter.com/mrgunn/status/1129033408628133888

`[2019-06-27]` https://web.hypothes.is/blog/annotation-is-now-a-web-standard/

`[2017-07-27]` YSK: You can see deleted posts by replacing the "r" in "reddit" with a "c" in the URL. [[reddit]]

`[2019-11-21]` twitter - Find the most liked tweet from an account - Web Applications Stack Exchange [[twitter]]

https://webapps.stackexchange.com/questions/105958/find-the-most-liked-tweet-from-an-account

Pop your handle into Social Bearing's Twitter Handle Search: Found Here. A dashboard should come up with all their tweets.

A super clean organization system does not actually help us retain knowledge. Rather, such system requires so much maintenance effort that it subverts the very thing that it promises to do–help us learn–. I ended up expanding an exorbitant amount of time managing tags, keywords, and hierarchy of data that I may never even retrieve. All in all, organizing knowledge should never become the goal when building a personal knowledge base. [[pkm]] [[toblog]]

None
How I Built a Personal Knowledge Base for Myself
in context

StorexHub is our offline-first API and plugin platform that allows you to work with Memex data outside of the browser. But it also works between different apps, making it a bit like an offline-first Zapier. You can query Memex data, listen to changes or write to its database. [[worldbrain]]

None
Vision, Mission & Values — 2020 Update
in context

https://mobile.twitter.com/ankitmalik/status/1227636734478831618 [[annotation]] [[gadget]]

https://mobile.twitter.com/ankitmalik/status/1227636734478831618

Nova Boox Pro e-ink writer similar to remarkable?

When you run into a new YT channel, go through it on computer, add good videos to a separate playlist, then watch without hassle [[pkm]] [[habit]]

Fuzzy Anchoring – Hypothesis [[annotation]] [[hypothesis]]

https://web.hypothes.is/blog/fuzzy-anchoring/

`[2019-07-04]` Discovering Hypothes.is | Luis Puerto [[hypothesis]]

https://luispuerto.net/blog/2019/02/10/discovering-hypothesis

`[2019-10-10]` Just an ok overview, I think I cover same if not more

`[2019-07-06]` Overview of the Hypothesis System : Overview of the Hypothesis System [[hypothesis]]

https://web.hypothes.is/help/overview-of-the-hypothesis-system/

`[2020-05-27]` Subscribe Hypothesis annotations [[hypothesis]]

https://diegodlh.github.io/hfeed/

`[2019-03-17]` Building a Second Brain: Capturing, Organizing, and Sharing Knowledge Using Digital Notes - YouTube [[pkm]]

https://www.youtube.com/watch?v=SjZSy8s2VEE&list=WL&index=61
eh, nothing too exciting

`[2019-02-13]` Designing a Personal Knowledgebase – A Curious Mix [[pkm]]

http://www.acuriousmix.com/2014/09/03/designing-a-personal-knowledgebase

`[2019-04-13]` ok, his system is not flexible enough for me, but somments are decent in terms of motivation and showing different approaches to pkm

`[2019-12-04]` I suppose it's more of a research assistant/references tool, so not exactly for me [[zotero]]

`[2019-06-23]` HighlightAll – Get this Extension for 🦊 Firefox (en-US) [[search]]

https://addons.mozilla.org/en-US/firefox/addon/highlightall/?src=search
doesn't seem like it can do specific predefined search terms

`[2019-03-12]` Tagging is Broken | Praxis [[pkm]]

https://praxis.fortelabs.co/tagging-is-broken-11e46eb24979/

`[2020-07-01]` Searchfox [[search]]

`[2019-05-10]` Internet Search Tips - Gwern.net [[pkm]] [[search]]

https://www.gwern.net/Search

`[2019-06-13]` ok, not so useful for me, but might be good to recommend to newbies

`[2019-12-02]` you will forget things [[exobrain]] [[motivation]]

> Most of your life is not fun
> Your loved ones don't want every piece of your daily minutiae, really, they don't
I'm not sure what to say to this. Try to have more fun? :)

 > You never forget the best times, the rest is unimportant
Empirically untrue, sadly. From reminiscing with friends, it's clear that both they and I have forgotten some of the best times, since I remember some of the best times and have forgotten others, and vice versa. I can remember that I had quite a bit of fun during the late eighties, but the vast majority of the detail is gone. When I've written down decade-old memories and looked at them a decade after that, it really, really often happens that I'm disturbed at how differently I remembered that event when I was halfway closer to it than now. Human memory is so sketchy and malleable that it's just barely useful at all. :(

https://news.ycombinator.com/item?id=5285929

`[2019-01-17]` https://treeverse.app/ tool to navigate twitter threads [[twitter]]

`[2018-11-07]` JacobEvelyn/friends: Spend time with the people you care about. Introvert-tested. Extrovert-approved. [[social]] [[pkm]]

https://github.com/JacobEvelyn/friends#overview

`[2020-01-30]` Build the ultimate personal knowledge management system /r/productivity [[pkm]]

Hi, thanks for that detailed comment and all the resources you linked! It'll take some time to look at all of them and transfer your knowledge to this project.
So I'm focused on developing Frontends, but I asked a friend who is very strong in building backends. We agreed that we have to try to develop a modern version org-mode with all the features we need.
Something like [https://remotestorage.io/](https://remotestorage.io/)  what [kureshii](https://www.reddit.com/user/kureshii/) mentioned. The base idea is to build a system based on Microservices which will be specialized in certain tasks, like file formats. But all of the services will be available through one unified API. And everybody can decide how they want to consume the data, we'll provide a JS Client Side Libary. E.g. I want a dedicated Notes and ToDo app, but also something an app to organize projects where I can See notes and todo lists in relation to a project. And due to the fact that everything will be Open Source everybody can build their own Microservice, eg to add a service to make iCloud files available.
And it'll be easy to set up because everything will be dockerized and hopefully up with only one command. And maybe in the long term we can think about a hosted version because I think that should be service everybody not only IT people should use. Yes, you lose the freedom to have everything on the server you want, but at least you have a centralized backup of all your data. And one of our focus topics will be an easy export function as markdown and if you want you could automize this to a 3rd party solution. But that's a long way to go :)
Due to the interest, I created a new Twitter account: [https://twitter.com/The\_Minerva\_](https://twitter.com/The_Minerva_)  and already a GitHub Org [https://github.com/Minerva-Development](https://github.com/Minerva-Development) .
I would be happy if we could stay in contact :)
Thank you!

PS: Yes we may reinvent the wheel, but we'll use what is already there, at least concepts and specs :)

`[2019-12-09]` As We May Think (1945) [[pkm]]

https://www.theatlantic.com/magazine/archive/1945/07/as-we-may-think/303881/

Piotr Limanowski 🔥 Reading for Programmers [[productivity]] [[pkm]]

https://codearsonist.com/reading-for-programmers

Interleave mode nice, but only works for specific PDF file I'd imagine?

`[2020-04-23]` dbohdan/structured-text-tools: A list of command line tools for manipulating structured text data

kobo – can't highlight in pocket items… [[kobo]]

A Cosmology for a Different Computer Universe: Data Model, Mechanisms, Virtual Machine and Visualization Infrastructure | Nelson [[pkm]]

https://journals.tdl.org/jodi/index.php/jodi/article/view/131/129
hmm interesting.
TLDR: each knowledge item participates in a linked list called 'dimension'

`[2019-06-01]` Capstone, a tablet for thinking [[inspiration]] [[pkm]]

https://www.inkandswitch.com/capstone-manuscript.html

`[2019-06-14]` I guess it's not for me, too fuzzy.. but could be good for artists etc

`[2019-06-30]` Software I like: PDF readers and manipulators [[annotation]]

http://audilab.bmed.mcgill.ca/~funnell/swil_pdf.html

Editing and annotating

`[2019-02-13]` A Complete Guide to Tagging for Personal Knowledge Management | Praxis [[tagging]] [[pkm]]

https://praxis.fortelabs.co/a-complete-guide-to-tagging-for-personal-knowledge-management/

`[2019-03-12]` ok, nothing too enlightening I suppose

`[2020-12-31]` Personal Knowledge Management – The Fortune Labs [[toblog]] [[pkm]]

three step process

`[2020-06-06]` Why I take notes of everything I learn | Ramses' Blog [[pkm]] [[notes]]

`[2019-02-11]` Welcome! [[physics]] [[inspiration]] [[pkm]]

https://physicstravelguide.com/start
pretty cool in detail guide

`[2019-07-16]` TagSpaces - Your versatile file manager [[pkm]] [[tagging]]

https://www.tagspaces.org/

[2019-07-23] dunno, maybe it could be useful for photo tagging, but that's not too high of priority to me now

`[2021-01-17]` Zotero best practices - Knowledge management - Obsidian Forum

`[2020-12-31]` Luca Ongaro - MiniSearch, a client-side full-text search engine [[search]]

MiniSearch offers an auto-suggestion feature out of the box. For example, for the partial search “uni”, MiniSearch could suggest “university”, “unicorn”, etc. The suggestions are calculated on the actual documents, and sorted by relevance. This feature can be used to implement auto-completion, like in the demo application shown above. Lunr does not currently offer this feature.

`[2020-09-13]` Web Clipper Browser Extension with Automatic Content Extraction, Now Open Source | Hacker News

`[2020-04-01]` You are my spirit animal. I just got a polar/readwise/orgmode/Anki setup togeth… | Hacker News [[remarkable]]

https://news.ycombinator.com/item?id=22608287

You are my spirit animal.
I just got a polar/readwise/orgmode/Anki setup together and I'd love to use this.

`[2020-03-31]` Kill the newsletter: Convert newsletters into RSS feeds | Hacker News [[rss]]

https://news.ycombinator.com/item?id=12949154

`[2019-12-30]` Hacker News RSS [[rss]] [[hackewnews]]

https://edavis.github.io/hnrss/

`[2019-08-28]` RomanPlusPlus/mindfilesResources: A collection of resources related to mindfiles (digital representations of your mind) [[github]] [[rss]]

https://github.com/RomanPlusPlus/mindfilesResources

You can also subcribe to changes using RSS.

huh, didn't know that!!

`[2019-12-03]` How to annotate literally everything | beepb00p [[kobo]] [[annotation]]

https://beepb00p.xyz/annotating.html

In .kobo/Kobo/Kobo ereader.conf, add [FeatureSettings] ExportHighlights=true

`[2019-04-19]` inspiration: About – A Curious Mix [[qs]] [[pkm]]

http://www.acuriousmix.com/about
summary of software they use

using Reddit as search engine [[search]] [[reddit]] [[toblog]]

https://news.ycombinator.com/item?id=21403294

I'm interested in ways of fast processing of semistructured data like json (link to kython things?) [[toblog]] [[pkm]]

write about fmc? [[toblog]] [[pkm]]

`[2019-12-02]` Ask HN: How did you build up your personal knowledge base? | Hacker News

https://news.ycombinator.com/item?id=21332957

`[2019-12-03]` arguments for forgetting?

+1, I think this links well with Alan Kay's thoughts on book reading. Some of his insights from a (maybe famous) HN thread:

"Mind palace", forgetting, "relax!": https://news.ycombinator.com/item?id=11809676

"Oxbridge method": https://news.ycombinator.com/item?id=11805264

Not taking notes: https://news.ycombinator.com/item?id=11853258

Build the ultimate personal knowledge management system - productivity

https://www.reddit.com/r/productivity/comments/evjtlz/build_the_ultimate_personal_knowledge_management/

`[2020-01-30]` Digital Tools I Wish Existed | Hacker News [[pkm]]

https://news.ycombinator.com/item?id=21659876

What I see missing is an ecosystem of interoperable tools.
It would be great if I could have a location/format in which all my digital knowledge is stored. And then be able to use different tools which support multiple processes/flows:

- a flow for discovering content
- a flow for archiving the highlights I take on the web
- a flow for writing notes

it would be great if I could change any tool while keeping the flow intact.
The only thing that somehow mirrors this is Evernote + Readwise + IFTT. There are tons of integrations that allow you to populate Evernote from tweets, Highly, Kindle highlights, etc. What I would love is if I could easily swap Evernote with any other editor (e.g. Bear) without changing much.
I wouldn't mind paying for these tools I would just like this personal knowledge software to work in a way in which you can natively add blocks/functionality to it. Most of them have huger vendor lock in.

interesting approah; "content discovery flow" seems like a good post title?

https://news.ycombinator.com/item?id=21653923 [[pkm]] [[annotation]]

Yes, this siloing stops me from using annotation features "native" to each app and format as such as well.
Instead, I prefer to exfiltrate information from the silos(apps, formats, etc) and put them into my note taking system. Then I can do highlights, annotations, etc. on my own terms and also get the benefits of centralization such as searching and linking(the OP has another post describing their own system, which is pretty cool[1]). Currently I'm using Notion, which is also a silo of its own, but it's one that gives me a lot of control over how I lay my information out(and an escape plan from).
There are a lot of perspectives on this issue with data silos and walled gardens. But I'm of the opinion that it's a fairly bad state for all of us "end users". Computers to me are about infinite flexibility and malleability, but ironically the tools we have for annotation and remixing are in practice worse than what we have in the physical world. Reading a book in the physical world, I can converse with the author simply by jotting marginalia with my pencil. It's fluid, intuitive, and the medium of paper encourages it(in fact it can't help but be mutated by my use!: pages get bended, stained, torn, etc.). If I want to go further I can add post-it notes to mark interesting passages, I can xerox some pages and create subsections, if it's a magazine I can just tear them all out! That kind of flexibility just isn't available on a computer.
I think it's worth thinking really hard why we're in this state, especially since computing pioneers were actually very optimistic that data and computing would be way more personally malleable than it is now(I've been working on a small comic on this theme myself[2]). For example, check out this short demo[3] of Smalltalk where Alan Kay hooks up a single frame from an animation of a bouncing ball to a painting program, to modify that one frame while also monitoring the loop. Smarter than paper, but way more flexible.

[1] https://beepb00p.xyz/pkm-search.html
[2] https://twitter.com/yoshikischmitz/status/1188455560045158400
[3] https://youtu.be/AnrlSqtpOkw?t=607

basically my thoughts

process .archive, but show them at the very end? similar with ignored files maybe? [[pkm]] [[search]]

`[2020-12-28]` https://github.com/jameslittle230/stork [[search]]

[2020-12-29] ugh shit. seems that it only supports document level granularity

rename to 'my personal knowledge and information' setup? also how to cope with fleshy body and brain? [[pkm]] [[infra]] [[toblog]]

`[2020-05-03]` Don't Do Complex Folder Hierarchies - They Don't Work and This Is Why and What to Do Instead [[toblog]] [[tagging]]

`[2020-05-01]` (1) jestem króliczkiem on Twitter: "@cj_pais I've had this existential crisis with browser bookmarks few years ago, which made me switch to Pinboard" / Twitter [[toblog]] [[pkm]]

I've had this existential crisis with browser bookmarks few years ago, which made me switch to Pinboard

prompts for possible post about bookmarks…

`[2021-01-17]` annotation-talks

if you search the obsidian forums for Zotero best practices it's prob the best repository for all of that! I keep meaning to write all this out but haven't had the chance

`[2021-01-25]` Everything I Know – Wiki | Hacker News

Agree with your sentiment. Contextuality and Applicability are definitely two main components when it comes to knowledge acquisition. But there are people who just derive pleasure from learning, irrespective of whether the concepts are connected or disjoint, and I think it is very important that we have all variety of people, and encourage them into pursuing what gives them satisfaction.

`[2021-01-20]` RyanGreenup/cadmus: Shell Scripts to Facilitate Effective Note Taking [[pkm]]

`[2019-12-30]` The Zettelkasten Method - LessWrong 2.0 https://www.lesswrong.com/posts/NfdHG6oHBJ8Qxc26s/the-zettelkasten-method-1

`[2019-07-06]` Annotating Books! | Books & Writing Amino https://aminoapps.com/c/books/page/blog/annotating-books/oZid_uQnM4VY6XwzlqgmE8qNLENlEr

`[2019-06-19]` that's why we can't have nice PDFs : linux https://www.reddit.com/r/linux/comments/yr180/thats_why_we_cant_have_nice_pdfs/

Okular

`[2020-01-05]` What tools do you use to maintain a personal log/journal ? | Lobsters https://lobste.rs/s/peevtw/what_tools_do_you_use_maintain_personal

`[2019-11-20]` How to not use Google search - Shahinism https://shahinism.com/en/posts/alternative-to-google-search/ [[search]]

`[2019-09-02]` bryanph/GeistMap: A personal knowledge base/network with a focus on connections https://github.com/bryanph/GeistMap

`[2020-05-07]` returntocorp/semgrep: like grep but for code: fast and syntax-aware semantic code pattern search for many languages [[search]]

`[2019-09-21]` full-stack monastic 🧘‍♂️🗺 on Twitter: "tags are useful as a secondary organizational method, especially as the # of notes you have increases. don’t tag everything ahead of time. wait until you have many notes to process, then build structure. you can create custom tags specific to your profession or big projects. https://t.co/CtlOvTNDzm" / Twitter

https://twitter.com/tasshinfogleman/status/1083157910257975298

tags are useful as a secondary organizational method, especially as the # of notes you have increases. don’t tag everything ahead of time. wait until you have many notes to process, then build structure. you can create custom tags specific to your profession or big projects.

`[2021-01-03]` Ask HN: What Do You Think? | Hacker News

The problem (IMHO) around notes, scheduling, and productivity apps is that they have only subset of features that a given user needs. User workflows are very unique and diverse. Some may prefer calendar integration, some may not. Others may prefer inline image support while some only require text. The examples are endless. It seems inevitable that a note/scheduling/productivity app can only bloat user experience while being in the infinite race to onboard features their users/competitors demand.

`[2020-05-11]` Erik Allberg on Twitter: "As Erik's tweets get influence, I have to comment, with the risks of what is happening around networked text (Ex Roam, OrgRoam, OpenRoam, Athens, Dumbledore. ex. Live without 2nd brain? Risk @nntaleb Cult around Roam? Nah / Syntheism @Bardissimo Scenario:Dumbledore non-profit" / Twitter

As Erik's tweets get influence, I have to comment, with the risks of what is happening around networked text (Ex Roam, OrgRoam, OpenRoam, Athens, Dumbledore.

`[2021-01-29]` Artificial Brain Networked notebook app

table with comparison of note taking apps: roam/logseq/dendrom/org-roam etc

`[2020-11-24]` ice9 on Twitter: "@tentontintin It's even more ambiguous at this point, given the useless new 'BERT' NLP system used for generating results– it routinely ignores terms from the query, even ones with obvious semantic importance, so results are often entirely irrelevant to the complete requested term set." / Twitter [[google]] [[search]]

It's even more ambiguous at this point, given the useless new 'BERT' NLP system used for generating results-- it routinely ignores terms from the query, even ones with obvious semantic importance, so results are often entirely irrelevant to the complete requested term set.

need "NEXT" todo entry? this would mean I need to actively act on something? [[pkm]]

`[2021-04-29]` soulisalmed/biff: Extract text and images from highlighted pdf generated with reMarkable tablet. [[pkm]] [[remarkable]]

⥅ node [[ppm]] pulled by Agora

📓 garden/neil/ppm.md by @neil

ppm

The ratio of carbon dioxide molecule concentrations in the atmosphere is counted in parts per million – or ppm. Before the industrial revolution, CO2 levels were around 280 ppm. By February 2022 they stood at 419 ppm, the highest level since the Pliocene era four million years ago, when temperatures were between 3-4 degrees hotter, and sea levels were 5-40 metres higher

– Down to Earth newsletter

⥅ node [[pr]] pulled by Agora

📓 garden/flancian/pr.md by @flancian

PR

A [[pull request]].
- A flow in which one person requests that a change present in a branch of a [[git]] repository is incorporated into another [[branch]], usually the [[main]] of some [[repository]].
- The usual way to contribute meaningful changes to projects in [[modern day open source]].
- A [[diff]].
A concept in the [[gitlab]]/[[github]] layer, not core to [[git]] proper. It usually involves a [[review flow]].

⥅ node [[prs]] pulled by Agora

📓 garden/flancian/prs.md by @flancian

Prs

[[pull]] [[pull requests]]
- A [[set]] of items of [[type]] [[pr]].

📓 garden/flancian/PRs.md by @flancian

#go https://github.com/search?q=is%3Aissue+is%3Aopen+user%3Aflancian&type=pullrequests
- This is all open PRs across all repos.
- This link only works for me, fix the search to point to your username as needed :)
- See also: [[bugs]].

⥅ node [[pt]] pulled by Agora

📓 garden/flancian/pt.md by @flancian

pt

a [[language]]
- [[pull]] [[portuguese]]
a [[timezone]]
- [[pull]] [[pacific time]]
- [[pst]] or [[pdt]] depending on the time of the year

⥅ node [[qft]] pulled by Agora

📓 garden/karlicoss/physics/qft.md by @karlicoss

[2019-02-22] Tong qft book
- [2019-02-23] shit. ok, I guess I sort of figured that out
[[Klen-Gordon equation]] [[kleingordon]]
[[Peskin – recommended by Baez]] [[qft]] [[book]]
- [2019-03-25] p. 17 We can think of the three terms, respectively, as the energy cost of "moving"in time, the energy cost of "shearing" in space, and the energy cost of havingthe field around at all. We will investigate this Hamiltonian much further inSections 2.3 and 2.4.
[2019-02-11] Quantum Field Queries /r/AskPhysics
[2019-02-11] Why can precomputed sets of lattice QFT field configurations be used to measure arbitrary observables? /r/askscience
[Daniel and Jorge Explain the Universe] What is the real charge of the electron? danielAndJorgeExplainTheUniverse https://podcastaddict.com/episode/106315566 via @PodcastAddict
[[cccccccccccchrome-extension://bjfhmglciegochdpefhhlphglcehbmek/content/web/viewer.html?file=https%3A%2F%2Farxiv.org%2Fpdf%2F1410.6753.pdf]]
- [[man, this pdf is fucking cool. realltry to understand it.]]
[2020-08-14] David Skinner – Advanced Quantum Field Theory – University of Cambridge
[2019-12-23] Объясняем шутку из твиттера про дедушку и лагранжиан квантовой теории поля
[2019-02-19] (12) Quantum Fields: The Real Building Blocks of the Universe - with David Tong - YouTube
[2019-06-23] A Brief Intro to Topological Quantum Field Theories. - YouTube [[qft]]
[2019-05-06] Self-energy - Wikipedia
[2018-08-23] Zee's book is a bit hard to read.. lots of jumping around and notation abuse… [[physics]] [[qft]]
[2020-10-19] https://en.wikipedia.org/wiki/Static_forces_and_virtual-particle_exchange
[[SU 2 = Spin 3]] [[drill]] [[qft]]
[[QFT in a nutshell]] [[study]]
[2019-12-28] Path Integral Salesman on Twitter: "As the pope of climate science, I declare as our holy book: https://t.co/nrvStKMcS4 https://t.co/nsHhCxX2XA" / Twitter
[2021-02-09] The Inaugural Atiyah Lecture: Jean-Pierre Bourguignon - What is Spinor? - Media Hopper Create [[towatch]] [[spinor]]

`[2019-02-22]` Tong qft book

index notation:

lover index: covariant, upper index: contravariant

∂f,ᵤ ≡ ∂ᵤf ≡ ∂f/∂xᵘ

gradient: ∇fᵤ ≡ ∂f/∂xᵤ – ok, makes sense…
gradient is covariant

field EL equation:
∂ᵤ ( ∂L/∂(∂ᵤϕ) ) - ∂L/∂ϕ = 0

free lagrangian: L = 1/2 ∂ᵤϕ ∂ᵘϕ - 1/2 m² ϕ²
or, L = 1/2 ηᵤᵥ ∂ᵤϕ ∂ᵥϕ - 1/2 m² ϕ²

∂L/∂ϕ = - m²ϕ
the other term: equal to ∂ᵘϕ hmm. if you treat ∂ᵤϕ as formal expression, that makes sense. there is nothing more to it, right? since it's a partial derivative with respect to expression.
wait, no, that doesn't explain the vanishing 1/2 term

`[2019-02-23]` shit. ok, I guess I sort of figured that out

express L = 1/2 (∂ϕ/∂t)² - 1/2 ( (∂ϕ/∂x)² + (∂ϕ/∂y)² + (∂ϕ/∂z)²) - 1/2 m ϕ²
∂L/∂(∂ᵤ ϕ) is actually a [co??]vector of (∂L/∂(∂ₜϕ), ∂L/∂(∂ₓϕ), ∂L/∂(∂_y ϕ), ∂L/∂(∂_z ϕ)), where ALL PARTIAL DERIVATIVES ARE KINDA LIKE INDEPEDENT SYMBOLS

soo, if we calculate each of them, we get (∂ₜ, -∂ₓ, -∂_y, -∂_z), which is ∂ᵘ ϕ

to calculate it the 'proper', tensor way:

TODO ??? now use ∂xᵢ/∂xⱼ = xᵢ,ⱼ = δᵢⱼ

∂L/∂(∂ᵤϕ) = (ignoring term with mass, which is although, actually an inner product, so nevertheless sort of interesting)
(note that L is a scalar!)
1/2 ∂(ηᵢⱼ ∂ᵢϕ ∂ⱼϕ)/∂ (∂ᵤϕ) = (chain rule, and use the fact that metric is constant for each index)
= 1/2 ηᵢⱼ ( ∂∂ᵢϕ/∂∂ᵤ ∂ⱼϕ + ∂ᵢϕ ∂∂ⱼϕ/∂∂ᵤ ϕ)
https://physics.stackexchange.com/a/3006/40624
use that ∂∂ᵢφ/∂∂ⱼφ = δʲᵢ
= 1/2 ηᵢⱼ (δᵘᵢ ∂ⱼϕ + ∂ᵢϕ δᵘⱼ )
this thing with delta works exactly as raising and picking the component?
= 1/2 δᵘᵢ ∂ⁱϕ + 1/2 δᵘⱼ ∂ʲϕ = 1/2 ∂ᵘϕ + 1/2 ∂ᵘϕ = ∂ᵘϕ

dunno, I did it kinda formally. how to figure that shit out quickly in general? probably no easier way especially considering that metric tensor is not constant in general.

http://www.continuummechanics.org/tensornotationadvanced.html
this helped a bit
https://www.physicsforums.com/threads/applying-euler-lagrange-to-real-klein-gordon-lagrangian.901389/
https://www.physicsforums.com/threads/klein-gordon-lagrangian.684071/
https://physics.stackexchange.com/questions/418382/derivation-of-klein-gordon-equation-in-general-relativity
https://physics.stackexchange.com/questions/340009/derivatives-in-euler-lagrange-for-fields

`[2019-02-23]` this still doesn't explain how to swap variation and partial derivatives properly…. I have to figure that out..

`[2019-02-23]` what's the lesson I learnt here? not sure. I still haven't found decent justifications to that crap.

`[2019-02-24]` ok, I skimmed it. the book is actually really good, I hightlighted some stuff and should read it again…

Klen-Gordon equation [[kleingordon]]

`[2019-02-24]` ok, so Klein-Gordon equation is for spin 0, such as Higgs, or pions

`[2019-01-25]` Is it true that the Schrödinger equation only applies to spin-1/2 particles? - Physics Stack Exchange

https://physics.stackexchange.com/questions/129667/is-it-true-that-the-schr%C3%B6dinger-equation-only-applies-to-spin-1-2-particles/129744

Well, this should not surprise us, since the Schrodinger equation is the nonrelativistic limit to the Klein-Gordon equation. And we should recall the Klein-Gordon equation describes spin-0 bosons!
The nonrelativistic limit c→∞c→∞ should not affect the spin of the particles involved. (That's why the Pauli model is the nonrelativistic limit of the Dirac equation!)

`[2019-02-15]` (11) Deriving The Klein Gordon Equation (Relativistic Quantum) - YouTube [[quantum]]

https://www.youtube.com/watch?v=bPlP9EkGixk
so apparently we can get klein-gordon if we replace energy and momentum with quantum operator in einsteins identity

`[2019-02-15]` (11) Deriving The Klein Gordon Equation (Relativistic Quantum) - YouTube

https://www.youtube.com/watch?v=bPlP9EkGixk
covariant has got overloaded meaning. covariant vector – lower index; covariant thing – transforms according to symmetry group

`[2019-02-26]` The Klein-Gordon equation doesn't seem to be complete. How can I use it for a general-purpose simulation? /r/Physics [[kleingordon]]

The Klein Gordon equation does not describe a quantum mechanical wavefunction. It describes a classical relativistic free field. To get quantum mechanical behavior out of this, you need to quantize this theory, moving to the world of quantum field theory.
That's a physics answer... In terms of how this fits into your game it would depend on what you're trying to do. But the bottom line is that QFT was essentially created to describe quantum mechanical effects in a relativistic setting.

`[2019-02-26]` Why does the Klein-Gordon equation describe bosons with spin equal to zero? /r/AskPhysics [[kleingordon]]

>Why can it still describe particles?
It can still describe particles if you give up the notion that the wavefunction represents a probability density. Instead, what you called the wavefunction should be promoted to a field operator in a second-quantized field theory.
>Why does it specifically describe bosons with spin 0, where does it say in the equation that particles with spin 0 use the KG-equation?
Because it's a scalar field. This implies that it's got no angular momentum.
For instance in the Dirac equation, the field operators are bi-spinors, meaning that you've got electrons and positrons both with spin-1/2.
For the photon field, the field operator is a vector (the vector potential), so the photon has spin-1.
It's all about how the field transforms under rotations. That tells you how many units of angular momentum the particles have.
>What is the physically reason why spin 1/2 have Dirac equation and Klein gordon equation spin 0?
This sort of ties in with the above.
If you haven't already, I'd suggest reading the last chapter of Sakurai. He goes into details about relativistic QM and shows the pitfalls that push you towards actual field theories.

`[2020-04-29]` PBS space time guy also recomments it!

`[2019-01-23]` Where can I go to learn more about spinors? /r/math [[spinor]] [[kleingordon]]

The mathematics behind spinors is pretty daunting. I think it's a realization of Clifford algebras (I could be mistaken; it's been some time since I've really been a physicist). You can learn about where they come from without the mathematical overhead. In quantum, spin is usually presented as some ad hoc property of particles. The way it came about was noting from experiment that basic particles like electrons had quantities which behaved a lot like *orbital* angular momentum without actually being bound to another particle! The orbital angular momentum operators were well understood and they can be abstractly viewed (via certain commutation relations).
If wavefunctions were just scalars, they couldn't possibly relate to the commutation relations they were seeing from orbital angular momentum so the next best thing is vectors. Well with this idea, the simplest (non scalar) vector is a two dimensional vector. Representing the algebra of spin operators on C^2 ended up giving the Pauli matrices and the theory gave results similar to that in experiment. This however is pretty unsatisfactory since it's very ad hoc. The theory didn't tell you which particles had spin, which didn't and it didn't really explain where it came from. 
Parallel to the development of regular quantum mechanics was the development of relativistic quantum mechanics. (Yes they were developed nearly at the same time and in fact Schrodinger envisioned relativistic quantum mechanics before his eponymous equation.) From Einstein's energy momentum relation E^2 = p^2 c^2 + m^2 c^4 came the Klein Gordon equation by replacing E with - i\*d/dt and p with i\*grad, neglecting factors of hbar. This looks pretty close to the usual wave equation for an electromagnetic wave, but with a mass term (which changes everything!).
The Klein Gordon equation had some serious issues with it. Even though it seemed to be a reasonable relativistic equation which actually reduces to the Schrodinger equation in a certain limit, it didn't preserve probabilities. Particularly the integral of psi\* psi over all space changed from one time to another, which is really bad! This breaks one of the foundational aspects of the Copenhagen interpretation: the integral of psi\* psi over all space is always 1 since we expect to find the particle *somewhere*. 
Dirac pinpointed where the issue was. If you consider the Schrodinger equation, the time derivative is a first order derivative. In the Klein Gordon equation, it's a second derivative with respect to time. I think he was able to prove/argue that this is actually where the problems come in. (These issues with the Klein Gordon equation were fixed later, ironically by Dirac's sea of particles idea: the negative probabilities were actually because the particle turned into an anti particle.) So.. What he set out to do was to eliminate one of the time derivatives but there isn't a super obvious way of doing that.
What he realized is that if you *factor* the equation into a product of two operators, you could in effect eliminate one of the time derivatives. The only way to do this is to have the operators actually be matrix valued (particularly they're 4 by 4 matrices or higher) and if the operators are matrices, then they must act on vectors.. So the solutions to his equation were vector valued wavefunctions! This is actually where spinors come from. 
There is one problem though. In the original quantum theory, they were two dimensional vectors. Dirac gave four dimensional vectors. What you find (after some relatively tedious analysis) is that in the non relativistic limit, two of the components are really small compared to the other two and their effects aren't really measured in a normal laboratory setting. 
For a self contained treatment of this, I *highly* recommend Griffiths' particle physics book. The Dirac equation is in chapter 7 if I recall correctly. I feel that the basics of relativistic quantum mechanics are very beautiful and are as close to an axiomatic (and painless) theory in physics as you're going to get.

`[2019-02-24]` How To Solve The Klein-Gordon Equation For The Hydrogen Atom - YouTube

https://www.youtube.com/watch?v=9_3uQdF-tEs
klein gordon solution for hydrogen

`[2019-02-24]` Klein-Gordon equation in nLab

https://ncatlab.org/nlab/show/Klein-Gordon+equation#FundamentalSolutions

where □g \Box_g denotes the wave operator on (X,g) (X,g)

`[2019-03-25]` Klein Gordon simulation 1 - YouTube

https://www.youtube.com/watch?v=DcbhHZugm8E

Peskin – recommended by Baez [[qft]] [[book]]

State "STRT" from "TODO" [2019-03-25]

`[2019-03-25]` p. 17 We can think of the three terms, respectively, as the energy cost of "moving"in time, the energy cost of "shearing" in space, and the energy cost of havingthe field around at all. We will investigate this Hamiltonian much further inSections 2.3 and 2.4.

`[2019-02-11]` Quantum Field Queries /r/AskPhysics

>I have a few conceptual questions about QFT.
>1.) Is renormalization a problem that comes from the use of perturbation theory, or is it something more fundamental?
Renormalization is not specific to perturbation theory. For a fully nonperturbative *description* of renormalization, consider the Wilsonian approach to the RG group flow.
>Does lattice QFT require the techniques of renormalization?
Lattice QFT *displays* renormalization as a feature. On a lattice a theory is simply defined as it is and scattering amplitudes are simply reduced (in principle) to an explicit finite QM problem - there are no field theory techniques to apply at all. Your system is not a QFT; the QFT appears (hopefully) in the limit of lattice spacing -> 0. If you put QED on a lattice you will see in the computed scattering amplitudes the running of α on the energy scale.
>3.) It is said that one can derive Einstein-like equations from a massless spin-2 field. Is this done by just using the most important Feynman diagrams, and neglecting the problematic higher order diagrams?
This is done keeping only tree-level diagrams, since GR is the classical limit of the quantum theory of gravitons. If you want, you can also add one-loop diags to obtain the hbar^(1) (or semiclassical) corrections to GR. However, you cannot go further since from two-loops onwards the theory is nonrenormalizable and so non-predictive.

`[2019-02-11]` Why can precomputed sets of lattice QFT field configurations be used to measure arbitrary observables? /r/askscience

My knowledge of quantum mechanics is rusty and my understanding of (lattice) quantum field theory on a very novice level at best, so it is likely my whole question is based on completely wrong assumptions and a lack of understanding.

Most introductory texts about QFT give some sort of a translation table between quantities in QM and QFT. (see e.g. [top of page 16 here](www.itp.uni-hannover.de/saalburg/Lectures/wiese.pdf) ). A given particle path (over all of which you integrate in the path integral formulation of QM to get the amplitude of a given process) is translated into a given field configuration in QFT (over all of which, again, you integrate in the path integral formulation of QFT).

As far as I understand, lattice quantum field theory calculations on big high-power computing clusters are effectively generating lots of field configurations (for a given lattice size, spacing, boundary conditions etc, but independent of any "starting conditions"). These field configurations are generated using metropolis MC methods (or similar more advanced importance sampling schemes), based on the action calculated for a given field configuration. In the "list" of output field configurations, the occurence of field configurations is then already weighted by their effective action, so that summing up over them yields the most relevant results without near infinite amounts of practically irrelevant field configurations.

To extract an observable from such a set of field configurations, one simply sums the value of the observable for all field configurations.

I wonder why it is possible and reasonable to extract any observable from a pre-computed number of field configurations that did not include any information about what observable one would like to obtain. In other words: how can the action of a field configuration be independent of the process I want to extract afterwards?


To maybe clarify a bit further, consider a simple double slit experiment: I want to calculate the QM amplitude of an electron at position A (on one side of the double slit) at time t0 to appear at position B (on the other side of the double slit) at time t1. For this I randomly generate a bunch of paths the satisfy the conditions of my observable (position A at t0, position B at t1) and evaluate their actions. If I want to be smart about it, I do some importance sampling of paths (Metropolis or whatever). However in this scenario, I only generated paths that were connected to the observable I knew I was looking for from the beginning (propagation A->B). I could not change the observable to a different transition amplitude afterwards and use the same paths.

So how do I unify these two pictures in my head? The only thing I can think of would be to not restrict the generation of QM paths to starting point A and ending point B, instead generating QM paths for all possible starting and end points. Afterwards, to calculate the desired transition amplitude, I could only sum up over paths going from A to B, which would have made the very most of my generated paths absolutely unnecessary. If that should be the case, why to LQFT calculations not restrict the generation of field configurations to such that give a meaningful contribution to a predefined observable?

[Daniel and Jorge Explain the Universe] What is the real charge of the electron? danielAndJorgeExplainTheUniverse https://podcastaddict.com/episode/106315566 via @PodcastAddict

OK this is pretty fascinating
Stuff in the freezer analogy for an electron charge
Electron is surrounded/shielded by a virtual cloud of positrons. So to measure charge +1, the real charge had to be infinite (renormalization)
Electron gets mass from higgs interaction, but also from virtual photons. But they act as a multiplier? If it wasn't for higgs, it'd have zero mass

cccccccccccchrome-extension://bjfhmglciegochdpefhhlphglcehbmek/content/web/viewer.html?file=https%3A%2F%2Farxiv.org%2Fpdf%2F1410.6753.pdf

 A situation could arise where we know what the symmetries of the objectare, but we might not know what the object really is.  This is sometimes enough to makepredictions.  For example, we can have a rigid object which is symmetric under rotations,2
with the symmetries of a circle.  Then we know that it will roll smoothly on a table.  It canbe a solid cylinder or a hollow cylinder, but both will roll smoothly on a table.  Of course,in other respects the hollow and solid cylinder can behave dierently.  For example, onecan
oat in water and the other might not.

then one finds that the condition for banks not to run out of either ofthe currencies, or that the net
ow of money across each bridge is zero, is equivalent toMaxwell's equations.

man, this pdf is fucking cool. realltry to understand it.

`[2020-08-14]` David Skinner – Advanced Quantum Field Theory – University of Cambridge

QFT in Zero Dimensions:

`[2019-12-23]` Объясняем шутку из твиттера про дедушку и лагранжиан квантовой теории поля

`[2019-02-19]` (12) Quantum Fields: The Real Building Blocks of the Universe - with David Tong - YouTube

https://www.youtube.com/watch?v=zNVQfWC_evg&list=WL&index=69
pretty good lecture, also turns out Tong is quite hilarious!

`[2019-06-23]` A Brief Intro to Topological Quantum Field Theories. - YouTube [[qft]]

https://www.youtube.com/watch?v=59uLGIrkMxM&list=WL&index=61&t=0s
I guess same stuff that Baez was writing about, didn't find talk particularly interesting

`[2019-05-06]` Self-energy - Wikipedia

The photon and gluon do not get a mass through renormalization because gauge symmetry protects them from getting a mass. This is a consequence of the Ward identity. The W-boson and the Z-boson get their masses through the Higgs mechanism; they do undergo mass renormalization through the renormalization of the electroweak theory.

`[2018-08-23]` Zee's book is a bit hard to read.. lots of jumping around and notation abuse… [[physics]] [[qft]]

`[2020-10-19]` https://en.wikipedia.org/wiki/Static_forces_and_virtual-particle_exchange

There are limits to the validity of the virtual particle picture. The virtual-particle formulation is derived from a method known as perturbation theory which is an approximation assuming interactions are not too strong, and was intended for scattering problems, not bound states such as atoms.
For the strong force binding quarks into nucleons at low energies, perturbation theory has never been shown to yield results in accord with experiments,[3] thus, the validity of the "force-mediating particle" picture is questionable.
Similarly, for bound states the method fails.[4] In these cases the physical interpretation must be re-examined.
As an example, the calculations of atomic structure in atomic physics or of molecular structure in quantum chemistry could not easily be repeated, if at all, using the "force-mediating particle" picture

SU 2 = Spin 3 [[drill]] [[qft]]

QFT in a nutshell [[study]]

9 path integrals
12 Lagrangian

`[2019-12-28]` Path Integral Salesman on Twitter: "As the pope of climate science, I declare as our holy book: https://t.co/nrvStKMcS4 https://t.co/nsHhCxX2XA" / Twitter

https://twitter.com/litgenstein/status/1210890946201739269

@litgenstein
Such a great book, really clear description of renormalization

`[2021-02-09]` The Inaugural Atiyah Lecture: Jean-Pierre Bourguignon - What is Spinor? - Media Hopper Create [[towatch]] [[spinor]]

[2021-03-25] ok, interesting overview, but still quite intense mathematically…

⥅ node [[qr]] pulled by Agora

📓 garden/flancian/qr.md by @flancian

Qr

[[qrencode]]

⥅ node [[qs]] pulled by Agora

📓 garden/karlicoss/quantifiedself/qs.md by @karlicoss

[[tracking: #sleep]]
- [[UP24 bioimpedance]]
  - [[actually take a look at intervals after all! Maybe prot on one large picture?]]
- [[zeo band? apparently, went bust..]]
- [[how to assess quality of sleep properly??]]
- [[https://sleepjunkies.com/features/the-ultimate-guide-to-sleep-tracking/]]
- [[dreams: just org-mode]]
  - [[oneiroarium?]]
[[tracking: #location]]
[[tracking: #mood]]
[[tracking: #blood]]
[[tracking: #weight]]
- [[in particular, body composition]]
  - [[bioimpedance?]]
[[tracking: finances]]
[[tracking: #food]]
- [[nutrino]] [[nutrino]]
  - [2021-01-19] add screenshots
[[tracking: computer/phone usage]]
- [[#arbtt on desktop]]
- [[#rescuetime on phone]]
  - [2018-05-31] extracting activity data (e.g. sleep)
- [[http://www.qualitytimeapp.com/]]
  - [https://www.reddit.com/r/everymanshouldknow/comments/5o4cyb/emsk_about_an_app_called_quality_time_to_keep/dchj19y](#swwwrddtcmrvrymnshldknwcmskbtnppclldqltytmtkpdchjy TIDDLYLINK)
[[tracking: misc]]
- [[blood pressure?]]
- [[alcohol monitor?]]
- [[thyroid home test?]]
- [[cholesterol home test?]]
- [[gut biome? https://ubiome.com]]
- [[food Intolerance tests]]
[[cognitive testing]] [[cognitive]]
- [[cambridge brain sciences https://www.cambridgebrainsciences.com/]]
  - [exporting data: https://www.reddit.com/r/QuantifiedSelf/comments/7b5dt3/heres_a_quick_way_to_exportaccess_cambridge_brain/](#xprtngdtswwwrddtcmrqntfdsrsqckwytxprtccsscmbrdgbrn TIDDLYLINK)
- [[quantified mind … hasn't been updated for a while http://www.quantified-mind.com/about]]
- [[http://brainworkshop.sourceforge.net]]
- [[http://cognitivefun.net]]
[[other links]]
- [[https://github.com/woop/awesome-quantified-self]]
- [2017-09-29] [#C] Serge Faguet: https://hackernoon.com/im-32-and-spent-200k-on-biohacking-became-calmer-thinner-extroverted-healthier-happier-2a2e846ae113
[[related]] [[sleep]] [[exercise]] [[longevity]]
[[My fundamental colclusion ??? it's that I don't trust himself lhuman (and especially my) ability to detect weak signals]] [[qs]] [[toblog]]
[[many hrv points are 0. wtf???]] [[emfit]] [[sleep]]
[[hrv is 0 on some days… need to refresh the data do double check?]] [[emfit]] [[sleep]]
[[at least, track tea and coffee maybe?]]
[2019-05-03] index - HumanMicrobiome https://old.reddit.com/r/HumanMicrobiome/wiki/index#wiki_testing.3A
[2019-06-13] Quantified Health Prize results announced - LessWrong 2.0 https://www.lesswrong.com/posts/yMKfih99nSqRyphkD/quantified-health-prize-results-announced
[2021-01-03] Essux/Quantified-Self-Reports
[[questions i want answered: can i have a smart alarm that actually works? Like, detects hrv or sleep phase or something and wakes me up?]] [[qs]] [[sleep]]
[2021-02-06] Cooper test - Wikipedia [[qs]] [[vo2]]
[2021-01-31] Strength Level - Weightlifting Calculator (Bench/Squat/Deadlift) [[wledger]]
[[Correlate sleep with rescuetime/arbtt data?]] [[qs]] [[sleep]]
[[Heat plot hr at specific hour + sunrise]] [[qs]] [[sleep]]
[2021-02-06] New Oura vs Emfit QS? - Quantified Self Forum [[emfit]] [[sleep]] [[oura]]
[[ok, so could check movement sounds against emfit/garmin?]] [[emfit]] [[qs]] [[garmin]] [[sleepasandroid]]
[XPOST] JotaJade has documented every hour of 2020! [[qs]] [[inspiration]]
[2021-03-25] qsdb/docs: Quantified Self Database (QSDB) Documentation

Why? It's fun (at least subjectively).
I'm trying to work on objectively useful things (diet, exercise, sleep), and quantifying keeps me motivated to to more research and get rigorous understanding of how body works.

About the data I collect: https://beepb00p.xyz/my-data.html

tracking: #sleep

need to update this section properly
at the moment I'm using Emfit QS for actual data, and manual org-mode tracking for subjective stats after sleep

UP24 bioimpedance

actually take a look at intervals after all! Maybe prot on one large picture?

zeo band? apparently, went bust..

see gwern blog

how to assess quality of sleep properly??

https://sleepjunkies.com/features/the-ultimate-guide-to-sleep-tracking/

dreams: just org-mode

oneiroarium?

tracking: #location

google maps
swarm

tracking: #mood

tracking: #blood

medichecks
thriva

tracking: #weight

in particular, body composition

bioimpedance?

apparently, not very precise, fluctuates a lot depending on water intake

tracking: finances

#hledger
drebedengi

tracking: #food

nutrino [[nutrino]]

`[2021-01-19]` add screenshots

tracking: computer/phone usage

#arbtt on desktop

#rescuetime on phone

`[2018-05-31]` extracting activity data (e.g. sleep)

http://www.qualitytimeapp.com/

https://www.reddit.com/r/everymanshouldknow/comments/5o4cyb/emsk_about_an_app_called_quality_time_to_keep/dchj19y

I tried this app for several weeks but gave up because it was blatantly inaccurate. It will log time of apps running in the background. When I had two browser windows opened it would double my time assuming I was looking at both windows simultaneously.
The one thing it did well was count how many times you unlock the phone, which surprised me I checked it as often as I did, but I was pretty sure I didn't play candy crush for 6 hours straight while I was sleeping. [reddit]

tracking: misc

blood pressure?

alcohol monitor?

The only way to get an accurate reading of your BAC is with a blood draw. The PBTs the police use on the side of the road are wildly inaccurate, and even the more advanced ones they use at the police stations/car breathalyzers still have their problems with calibration.
I doubt one you can buy at a store is going to be accurate at all, so my advice would be not to waste your money.

thyroid home test?

cholesterol home test?

gut biome? https://ubiome.com

food Intolerance tests

https://www.testmyintolerance.com/product/advanced-intolerance-test/
meh, unlikely it would show anything useful

cognitive testing [[cognitive]]

cambridge brain sciences https://www.cambridgebrainsciences.com/

https://www.cambridgebrainsciences.com/assets/Main/Cambridge_Brain_Sciences_Sample_Brain_Report.pdf

exporting data: https://www.reddit.com/r/QuantifiedSelf/comments/7b5dt3/heres_a_quick_way_to_exportaccess_cambridge_brain/

quantified mind … hasn't been updated for a while http://www.quantified-mind.com/about

ugh, apparently, it only has five experminents

http://brainworkshop.sourceforge.net

http://cognitivefun.net

related [[sleep]] [[exercise]] [[longevity]]

My fundamental colclusion ??? it's that I don't trust himself lhuman (and especially my) ability to detect weak signals [[qs]] [[toblog]]

many hrv points are 0. wtf??? [[emfit]] [[sleep]]

hrv is 0 on some days… need to refresh the data do double check? [[emfit]] [[sleep]]

at least, track tea and coffee maybe?

`[2019-05-03]` index - HumanMicrobiome https://old.reddit.com/r/HumanMicrobiome/wiki/index#wiki_testing.3A

`[2019-06-13]` Quantified Health Prize results announced - LessWrong 2.0 https://www.lesswrong.com/posts/yMKfih99nSqRyphkD/quantified-health-prize-results-announced

`[2021-01-03]` Essux/Quantified-Self-Reports

questions i want answered: can i have a smart alarm that actually works? Like, detects hrv or sleep phase or something and wakes me up? [[qs]] [[sleep]]

`[2021-02-06]` Cooper test - Wikipedia [[qs]] [[vo2]]

The results can be correlated with VO2 Max.

max distance ran in 12 mins

`[2021-01-31]` Strength Level - Weightlifting Calculator (Bench/Squat/Deadlift) [[wledger]]

Correlate sleep with rescuetime/arbtt data? [[qs]] [[sleep]]

Generally correlate time before asleep?

Heat plot hr at specific hour + sunrise [[qs]] [[sleep]]

`[2021-02-06]` New Oura vs Emfit QS? - Quantified Self Forum [[emfit]] [[sleep]] [[oura]]

ok, so could check movement sounds against emfit/garmin? [[emfit]] [[qs]] [[garmin]] [[sleepasandroid]]

[XPOST] JotaJade has documented every hour of 2020! [[qs]] [[inspiration]]

https://redd.it/lxc8gq

`[2021-03-25]` qsdb/docs: Quantified Self Database (QSDB) Documentation

QSDB, in its current alpha stage, comprises:
 a soft specification/schema of how to format and organize your personal data
 suggested tools for storing your data
 scripts and configuration files for deploying those tools

⥅ node [[rc]] pulled by Agora

📓 garden/flancian/rc.md by @flancian

rc

I keep a [[functions]] file.

https://twitter.com/flancian/status/1375511684186398720

⥅ node [[rdf]] pulled by Agora

📓 garden/flancian/rdf.md by @flancian

RDF

[[go]] https://www.w3.org/RDF/
- [[RDF 1.1]] documents:
  - [[RDF 1.1 Primer]]
  - [[RDF 1.1 Concepts and Abstract Syntax]]
  - [[RDF 1.1 XML Syntax]]
  - [[RDF 1.1 Semantics]]
  - [[RDF Schema 1.1]]
  - [[RDF 1.1 Test Cases]]
[[wikipedia]] https://en.wikipedia.org/wiki/Resource_Description_Framework
[[turtle]] seems simplest, but [[vera]] recommends [[quads]] / [[datalog]].
[[relevant]] for [[go links]], [[agora]].
[[ZornGerhard]] knows about it.
- Also mentioned the [[SPARQL]] query language: https://twitter.com/ZornGerhard/status/1310645329587560448
- [[open world assumption]] https://twitter.com/ZornGerhard/status/1355583399520587779
I should ask [[s.-s.]] about it.
[[see also]] [[turtle]], [[semantic triples]], [[solid]].
[[hypothesis]] RDF is enough to maintain a [[distributed knowledge graph]] collaboratively over the internet.
- [[hypothesis]] RDF is a good base for the [[agora protocol]].
[[twitter]] https://twitter.com/flancian/status/1342895193071230977
[[push]] [[do]]
- [[agora]] https://social.coop/web/statuses/105991450845454412
  - [[syntacticsugarglider]]

https://twitter.com/flancian/status/1379895535340040198

[[2020-12-26]]

I started a [[pomodoro]] of this but [[procrastination]] came up, interesting -- it's not like I'm not interested in this, but it just tends to happen I don't get to it because I'm busy with work and other things, so I ended up associating it with a frustrated feeling? Unsure. It could also be I have a fear of it being precisely the Agora, what that would mean. I should be elated if that happened, but on some level perhaps.
- [[the agora is a social network built by the people for the people]] feels like something that I wanted to write, so no regrets.
[[reading]] https://www.w3.org/RDF/
- "RDF is a standard model for data interchange on the Web. RDF has features that facilitate data merging even if the underlying schemas differ, and it specifically supports the evolution of schemas over time without requiring all the data consumers to be changed."
  - Nice.
- "RDF extends the linking structure of the Web to use URIs to name the relationship between things as well as the two ends of the link (this is usually referred to as a “triple”). Using this simple model, it allows structured and semi-structured data to be mixed, exposed, and shared across different applications." - I feel like the Agora plays well with this, and this plays well with the Agora. - [[actions]] for example are semantic triples: - They happen in a node that serves as current context; usually a [[subject]]. - They point to another Agora node or a [[url]], an [[object]]. - They contain a [[relationship]], the [[action]].
- "This linking structure forms a directed, labeled graph, where the edges represent the named link between two resources, represented by the graph nodes. This graph view is the easiest possible mental model for RDF and is often used in easy-to-understand visual explanations." - It sounds like RDF allows us to run a fully distributed [[graph]] / [[hypergraph]] over the internet. - Why has it not "taken over"? - What would "take over" mean?
- Related [[tools]]: - [[4store]] (triple store). - [[outdated-ARC RDF Store]] (triple store). Directly usable from PHP - [[AllegroGraph RDF Store]] (triple store programming environment reasoner development environment rdfs reasoner). Directly usable from Java LISP Python Prolog C Ruby Perl - [[Apache Jena]] (triple store programming environment reasoner rule reasoner owl reasoner rdfs reasoner parser). Directly usable from Java - [[Dojo.data]] (triple store programming environment). Directly usable from Javascript - [[FRED]] (rdf generator tagging knowledge graph extractor). - [[Mobi]] (programming environment development environment). Directly usable from Java Javascript - [[Mulgara Semantic Store]] (triple store). Directly usable from Java - [[OpenLink Virtuoso]] (triple store reasoner rdf generator sparql endpoint owl reasoner rdfs reasoner rdb2rdf). Directly usable from C C++ Python PHP Java Javascript ActionScript Tcl Perl Ruby Obj-C - [[Oracle Spatial and Graph 19c]] (triple store reasoner owl reasoner). Directly usable from Java - [[RDFLib]] (triple store programming environment). Directly usable from Python - [[RDFox]] (triple store reasoner owl reasoner rdfs reasoner rule reasoner). Directly usable from C++ Java - [[Redland RDF Application Framework]] (programming environment). Directly usable from C C-sharp Python Obj-C PHP Java Tcl Ruby Perl - [[Altova's SemanticWorks]] (editor development environment). - [[Sesame]] (triple store programming environment reasoner rdfs reasoner parser). Directly usable from Java Python PHP - [[Talis Platform]] (triple store sparql endpoint). - [[XMP (ISO 16684)]] (editor development environment).
[[reading]] [[wikipedia]] https://en.wikipedia.org/wiki/Resource_Description_Framework
- [[first public draft]] in [[1997]]. Backed by companies such as [[ibm]] [[microsoft]] [[netscape]].
- [[1.0]] was published as a standard in [[1999]], [[1.1]] in [[2014]].
  - "The RDF data model is similar to classical conceptual modeling approaches (such as [[entity–relationship diagrams]] or [[class diagrams]]). It is based on the idea of making statements about resources (in particular web resources) in expressions of the form subject–predicate–object, known as triples. The subject denotes the resource, and the predicate denotes traits or aspects of the resource, and expresses a relationship between the subject and the object. "
  - "For example, one way to represent the notion "The sky has the color blue" in RDF is as the triple:
  - [[sky]] [[has the color]] [[blue]].
  - Or [[sky]] [[color]] [[blue]]?
  - "Therefore, RDF uses subject instead of object (or entity) in contrast to the typical approach of an entity–attribute–value model in object-oriented design: entity (sky), attribute (color), and value (blue)."
  - RDF is an [[abstract model]]. There are several [[rdf serialization formats]].
  - See also: [[W3C]]'s [[Semantic Web]] activity: an evolutionary stage of the [[World Wide Web]] in which "automated software can store, exchange, and use [[machine-readable information]] distributed throughout the [[Web]], in turn enabling users to deal with the information with greater [[efficiency]] and [[certainty]]." Also used in [[knowledge management applications]] unrelated to Semantic Web activity.
  - [[RDFS]] and [[OWL]] are ontology languages built opon RDF.
  - [[common misunderstandings]]:
  - [[RDF]] [[is not]] for representing [[metadata]] only.
  - [[RDF]] [[is not]] an XML format, it rather is an [[abstract data model]].
Known applications
- [[RSS]] and [[FOAM]] are applications for RDF.
  - [[do]] check if RSS > 1.0 is an RDF application; [[wikipedia]] only mentions 1.0

⥅ node [[rea]] pulled by Agora

📓 garden/neil/rea.md by @neil

REA

[[Resources, Events, Agents]].

⥅ node [[red]] pulled by Agora

📓 garden/neil/red.md by @neil

Red

Often used as a shorthand for [[socialism]] and [[communism]].

⥅ node [[rez]] pulled by Agora

📓 garden/flancian/rez.md by @flancian

Rez

[[pull]] [[rezmason]]

⥅ node [[rfc]] pulled by Agora

📓 garden/flancian/rfc.md by @flancian

rfc

[[pull]] [[rfcs]]
[[pull]] [[agora rfc]]

⥅ node [[rms]] pulled by Agora

📓 garden/ankostis/data-liberation-talk/images/RMS.png by @ankostis

📓 garden/ankostis/data-liberation-talk/slides/images/RMS.png by @ankostis

📓 garden/flancian/rms.md by @flancian

rms

a [[hacker]]
- [[pull]] [[richard stallman]]

⥅ node [[rnn]] pulled by Agora

📓 garden/KGBicheno/Artificial Intelligence/Introduction to AI/Week 3 - Introduction/Definitions/Rnn.md by @KGBicheno

RNN

Go back to the [[AI Glossary]]

#seq

Abbreviation for recurrent neural networks.

⥅ node [[rpg]] pulled by Agora

📓 garden/flancian/rpg.md by @flancian

rpg

I'm into [[rpgs]], are you [[surprised]].

⥅ node [[rss]] pulled by Agora

📓 garden/flancian/rss.md by @flancian

Rss

📓 garden/jakeisnt/pages/rss.md by @jakeisnt

Notes on the RSS Protocol, a way of following blogs and articles in a decentralized fashion.

Kill the Newsletter! converts arbitrary email newsletters to RSS feeds. Likewise rss-bridge: The RSS feed for websites missing it attempts to graft RSS capabilities onto websites that don't support it any longer. Likewise, GitHub - bcongdon/rssfilter: 🔍 Web service for filtering RSS articles looks potentially useful for RSS.

Tiny Tiny RSS is a self-hosted RSS server that supports clients locally on a computer. I used this for awhile so that I could browse RSS on mobile and on desktop while using the same backend; as fun as it is to use newsboat and the web app, it's just not that fun to browse RSS feeds anymore - twitter is far more addictive, for better or for worse. FreshRSS, a free, self-hostable feeds aggregator also looks like a reasonable choice.

Welcome to twtxt! — twtxt 1.2.3 documentation is a microblogging service that borrows ideas from RSS, Twitter, Mastodon and other decentralized social media - it's absolutely worth looking into, though without network effects it's unclear whether it's ever worth using.

📓 garden/karlicoss/soft/rss.md by @karlicoss

`[2018-10-24]` Feeder

Feeder (RSS feed reader) - https://f-droid.org/app/com.nononsenseapps.feeder
it's ok I guess, but no feedly support. anyway I need at least something syncing to web

`[2018-01-06]` Greader

+ offline support, syncs with feedly

backup/restore config

`[2018-01-06]` Feedly

pretty nice in general, web version

hekko

Why I Still Use RSS | atthislink

https://atthis.link/blog/2021/rss.html

📓 garden/melanocarpa/rss.myco by @melanocarpa

RSS is the most popular format for web feeds, the other two being [[Atom]] and [[JSON feed]]. How do I know it is the most popular? The word RSS is sometimes used as a synonym for web feeds.

I support RSS, I subscribe to RSS feeds and find it very normal, and assume techy people to have heard of it.

It is very popular to lament about how RSS is not as big as it was back in the day. I wasn't there back in the day, but I do find web feeds like everywhere. Quite a strong tech, I think.

I use [[https://miniflux.app]] for reading feeds.

= Great unsubscribing As of 2023-05-05, I am subscribed to 175 feeds. I actually don't really need to be subscribed to some of them. I shall unsubscribe from some immediately. I have actually started doing so some time ago, but right now (19:52:35 UTC) I will unsubscribe real good.

Unsubscribed because of content: 10
Too much posts: 1
Unsubscribed because of not being available anymore: 2
Unsubscribed because of not being updated anymore: 5

After the unsubscribing, the number of feeds reduced down to 155. Something not checks out, yeah. Whatever, I shall unsubscribe from more stuff later on. Maintain your hygiene!

= Links => https://blog.danilax86.space/rss/ | Даня про RSS Помимо прочего описывает, как подписаться на твиттеры и ютубы через альтернативные фронт-енды.

=> https://idiomdrottning.org/re-thoughts-on-rss | Re: Thoughts on RSS Sandra responds to someone.

=> http://rachelbythebay.com/w/2022/03/07/get/ | A sysadmin's rant about feed readers and crawlers

📓 garden/neil/rss.md by @neil

RSS

⥅ node [[run]] pulled by Agora

📓 garden/flancian/run.md by @flancian

run

a [[planned action]].
it takes a URL and tries to interpret it as a program.
[[pull]] [[python subnodes]] [[js subnodes]]

⥅ node [[s-y]] pulled by Agora

📓 garden/flancian/s y.md by @flancian

S. Y.

[[birthday]] [[2021-12-24]]

⥅ node [[s3]] pulled by Agora

📓 garden/bmann/_notes/s3.md by @bmann

[[AWS]] Simple Storage Service

Making folders publicly readable in an Amazon S3 bucket

Give public read (get) access to certain folders.

{
    "Version": "2012-10-17",
    "Statement": [
        {
            "Effect": "Allow",
            "Principal": "*",
            "Action": "s3:GetObject",
            "Resource": "arn:aws:s3:::your.bucket.name/uploads/*"
        },
        {
            "Effect": "Allow",
            "Principal": "*",
            "Action": "s3:GetObject",
            "Resource": "arn:aws:s3:::your.bucket.name/video/*"
        }
    ]
}

⥅ node [[scc]] pulled by Agora

📓 garden/flancian/scc.md by @flancian

⥅ node [[set]] pulled by Agora

📓 garden/flancian/set.md by @flancian

set

[[pull]] [[set theory]]

⥅ node [[siw]] pulled by Agora

📓 garden/flancian/siw.md by @flancian

#pull [[synthesis infrastructures workshop]]
- (aside) led me to [[in silico]] through wikipedia search in the [[agora]] somehow
  - also to [[substrate-integrated waveguide]]

⥅ node [[sj]] pulled by Agora

📓 garden/flancian/sj.md by @flancian

#pull [[metasj]]

⥅ node [[sje]] pulled by Agora

📓 garden/flancian/sje.md by @flancian

#pull [[samuel klein]] [[jerry michalski]] [[eduardo ivanec]]

📓 stoa/doc.anagora.org/sje.md by @anonymous@doc.anagora.org

<title>500 Internal Error wtf.

<link rel="stylesheet" href="https://doc.anagora.org/css/center.css">

New
Publish
Extra
Revision
Slide Mode

            <li class="divider"></li>
            <li class="dropdown-header">Export</li>
            <li role="presentation"><a role="menuitem" class="ui-save-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
            </li>
            
            <li role="presentation"><a role="menuitem" class="ui-save-gist" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-github fa-fw"></i> Gist</a>
            </li>
            
            
            
            <li class="divider"></li>
            <li class="dropdown-header">Import</li>
            <li role="presentation"><a role="menuitem" class="ui-import-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-import-gist" href="#" data-toggle="modal" data-target="#gistImportModal"><i class="fa fa-github fa-fw"></i> Gist</a>
            </li>
            
            <li role="presentation"><a role="menuitem" class="ui-import-clipboard" href="#" data-toggle="modal" data-target="#clipboardModal"><i class="fa fa-clipboard fa-fw"></i> Clipboard</a>
            </li>
            <li class="divider"></li>
            <li class="dropdown-header">Download</li>
            <li role="presentation"><a role="menuitem" class="ui-download-markdown" tabindex="-1" href="#" target="_self"><i class="fa fa-file-text fa-fw"></i> Markdown</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-download-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> HTML</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-download-raw-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> Raw HTML</a>
            </li>
            <li class="divider"></li>
            <li role="presentation"><a role="menuitem" class="ui-help" href="#" data-toggle="modal" data-target=".help-modal"><i class="fa fa-question-circle fa-fw"></i> Help</a>
            </li>
        </ul>
        <a class="btn btn-link ui-mode">
            <i class="fa fa-pencil"></i>
        </a>
    </div>
</div>
<div class="collapse navbar-collapse">
    <ul class="nav navbar-nav navbar-form navbar-left" style="padding:0;">
        <div class="btn-group" data-toggle="buttons">
            <label class="btn btn-default ui-view" title="View (Ctrl+Alt+V)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-eye"></i>
            </label>
            <label class="btn btn-default ui-both" title="Both (Ctrl+Alt+B)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-columns"></i>
            </label>
            <label class="btn btn-default ui-edit" title="Edit (Ctrl+Alt+E)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-pencil"></i>
            </label>
        </div>
        <div class="btn-group" data-toggle="buttons">
            <label class="btn ui-night" title="Night Theme">
                <input type="checkbox" name="night"><i class="fa fa-moon-o"></i>
            </label>
        </div>
        <span class="btn btn-link btn-file ui-help" title="Help" data-toggle="modal" data-target=".help-modal">
            <i class="fa fa-question-circle"></i>
        </span>
    </ul>
    <ul class="nav navbar-nav navbar-right">
        <li id="online-user-list">
            <a class="ui-status" data-toggle="dropdown">
                <span class="label label-danger"><i class="fa fa-plug"></i> OFFLINE</span>
            </a>
            <ul class="dropdown-menu list" role="menu" aria-labelledby="menu" style="right: 15px;width: 200px;">
            </ul>
        </li>
    </ul>
    <ul class="nav navbar-nav navbar-right" style="padding:0;">
        <li>
            <a href="https://doc.anagora.org/new" target="_blank" rel="noopener" class="ui-new">
                <i class="fa fa-plus"></i> New
            </a>
        </li>
        <li>
            <a href="#" target="_blank" rel="noopener" class="ui-publish">
                <i class="fa fa-share-square-o"></i> Publish
            </a>
        </li>
        <li>
            <a data-toggle="dropdown">
                Menu <i class="fa fa-caret-down"></i>
            </a>
            <ul class="dropdown-menu list" role="menu" aria-labelledby="menu">
                <li class="dropdown-header">Extra</li>
                <li role="presentation"><a role="menuitem" class="ui-extra-revision" tabindex="-1" data-toggle="modal" data-target="#revisionModal"><i class="fa fa-history fa-fw"></i> Revision</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-extra-slide" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-tv fa-fw"></i> Slide Mode</a>
                </li>
                
                <li class="divider"></li>
                <li class="dropdown-header">Export</li>
                <li role="presentation"><a role="menuitem" class="ui-save-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
                </li>
                
                <li role="presentation"><a role="menuitem" class="ui-save-gist" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-github fa-fw"></i> Gist</a>
                </li>
                
                
                
                <li class="divider"></li>
                <li class="dropdown-header">Import</li>
                <li role="presentation"><a role="menuitem" class="ui-import-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-import-gist" href="#" data-toggle="modal" data-target="#gistImportModal"><i class="fa fa-github fa-fw"></i> Gist</a>
                </li>
                
                <li role="presentation"><a role="menuitem" class="ui-import-clipboard" href="#" data-toggle="modal" data-target="#clipboardModal"><i class="fa fa-clipboard fa-fw"></i> Clipboard</a>
                </li>
                <li class="divider"></li>
                <li class="dropdown-header">Download</li>
                <li role="presentation"><a role="menuitem" class="ui-download-markdown" tabindex="-1" href="#" target="_self"><i class="fa fa-file-text fa-fw"></i> Markdown</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-download-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> HTML</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-download-raw-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> Raw HTML</a>
                </li>
            </ul>
        </li>
    </ul>
</div>

<div class="container-fluid text-center">
    <div class="vertical-center-row">
        <h1>500 Internal Error <small>wtf.</small></h1>
    </div>
</div>

⥅ node [[skg]] pulled by Agora

📓 garden/neil/skg.md by @neil

skg

Found at : https://github.com/JeffreyBenjaminBrown/skg

Share Knowledge Graphs.

⥅ node [[slo]] pulled by Agora

📓 garden/flancian/slo.md by @flancian

Slo

[[pull]] [[service level objective]]
e.g. a service will be available 99.999% of the time.
- 'available' might mean 'usable at all' or 'responding to critical requests within 2 seconds'.

⥅ node [[smt]] pulled by Agora

📓 garden/jakeisnt/pages/smt.md by @jakeisnt

Once I understand this, this will be a tutorial on building a simple SAT or SMT solver - with inspiration from Pete's class. I can revisit the article then.

The Assembly Language of Satisfiability: Are we bad at SAT solvers? Where are we? How do we bring their power to people? (To me, this problem is a subset of the "make programming accessible" problem, so it's not noteworthy.)

SAT solvers

Cons

Require input problem to be a propositional logic formula in conjunctive normal form (CNF). This is not a natural way to express most problems that require SAT
Computing CNF formulas is often bad and hard so SAT solvers aren't really at the right "level" for use by the working programmer
Look up `cardinality constraints CNF` on google scholar - reveals lots of problems and tradeoffs that can be made

Why SMT over SAT?

SMT solvers allow more freedom in the expression of input problems - support integers, fixed width floats, arrays and potentially other datatypes, as well as common operations on those types, without requiring a specific normal form!
API that allows for the manipulation of the input formula exposed by the solver, unlike strict

How do they work?

Bit blasting

Directly convert input formula into an equivalent Boolean formula in CNF
Limited to formulas where every data type has a finite set of values
Need a SAT solver as a backend, any improvement to SAT translates directly to an improvement to an SMT solver - so this is just additional tooling around a SAT solver to make it much easier to use.

CDCL(T)

Definition: conflict driven cause learning - the algorithm employed by most modern SAT solvers.

⥅ node [[sp]] pulled by Agora

📓 garden/flancian/sp.md by @flancian

SP

⥅ node [[sre]] pulled by Agora

📓 garden/flancian/sre.md by @flancian

SRE

[[pull]] [[site reliability engineering]] [[site reliability engineer]]

⥅ node [[srs]] pulled by Agora

📓 garden/flancian/srs.md by @flancian

Srs

[[pull]] [[steffen-schuldenzucker]]

⥅ node [[ssh]] pulled by Agora

📓 stoa/doc.anagora.org/ssh.md by @anonymous@doc.anagora.org

<title>500 Internal Error wtf.

<link rel="stylesheet" href="https://doc.anagora.org/css/center.css">

New
Publish
Extra
Revision
Slide Mode

            <li class="divider"></li>
            <li class="dropdown-header">Export</li>
            <li role="presentation"><a role="menuitem" class="ui-save-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
            </li>
            
            <li role="presentation"><a role="menuitem" class="ui-save-gist" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-github fa-fw"></i> Gist</a>
            </li>
            
            
            
            <li class="divider"></li>
            <li class="dropdown-header">Import</li>
            <li role="presentation"><a role="menuitem" class="ui-import-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-import-gist" href="#" data-toggle="modal" data-target="#gistImportModal"><i class="fa fa-github fa-fw"></i> Gist</a>
            </li>
            
            <li role="presentation"><a role="menuitem" class="ui-import-clipboard" href="#" data-toggle="modal" data-target="#clipboardModal"><i class="fa fa-clipboard fa-fw"></i> Clipboard</a>
            </li>
            <li class="divider"></li>
            <li class="dropdown-header">Download</li>
            <li role="presentation"><a role="menuitem" class="ui-download-markdown" tabindex="-1" href="#" target="_self"><i class="fa fa-file-text fa-fw"></i> Markdown</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-download-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> HTML</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-download-raw-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> Raw HTML</a>
            </li>
            <li class="divider"></li>
            <li role="presentation"><a role="menuitem" class="ui-help" href="#" data-toggle="modal" data-target=".help-modal"><i class="fa fa-question-circle fa-fw"></i> Help</a>
            </li>
        </ul>
        <a class="btn btn-link ui-mode">
            <i class="fa fa-pencil"></i>
        </a>
    </div>
</div>
<div class="collapse navbar-collapse">
    <ul class="nav navbar-nav navbar-form navbar-left" style="padding:0;">
        <div class="btn-group" data-toggle="buttons">
            <label class="btn btn-default ui-view" title="View (Ctrl+Alt+V)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-eye"></i>
            </label>
            <label class="btn btn-default ui-both" title="Both (Ctrl+Alt+B)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-columns"></i>
            </label>
            <label class="btn btn-default ui-edit" title="Edit (Ctrl+Alt+E)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-pencil"></i>
            </label>
        </div>
        <div class="btn-group" data-toggle="buttons">
            <label class="btn ui-night" title="Night Theme">
                <input type="checkbox" name="night"><i class="fa fa-moon-o"></i>
            </label>
        </div>
        <span class="btn btn-link btn-file ui-help" title="Help" data-toggle="modal" data-target=".help-modal">
            <i class="fa fa-question-circle"></i>
        </span>
    </ul>
    <ul class="nav navbar-nav navbar-right">
        <li id="online-user-list">
            <a class="ui-status" data-toggle="dropdown">
                <span class="label label-danger"><i class="fa fa-plug"></i> OFFLINE</span>
            </a>
            <ul class="dropdown-menu list" role="menu" aria-labelledby="menu" style="right: 15px;width: 200px;">
            </ul>
        </li>
    </ul>
    <ul class="nav navbar-nav navbar-right" style="padding:0;">
        <li>
            <a href="https://doc.anagora.org/new" target="_blank" rel="noopener" class="ui-new">
                <i class="fa fa-plus"></i> New
            </a>
        </li>
        <li>
            <a href="#" target="_blank" rel="noopener" class="ui-publish">
                <i class="fa fa-share-square-o"></i> Publish
            </a>
        </li>
        <li>
            <a data-toggle="dropdown">
                Menu <i class="fa fa-caret-down"></i>
            </a>
            <ul class="dropdown-menu list" role="menu" aria-labelledby="menu">
                <li class="dropdown-header">Extra</li>
                <li role="presentation"><a role="menuitem" class="ui-extra-revision" tabindex="-1" data-toggle="modal" data-target="#revisionModal"><i class="fa fa-history fa-fw"></i> Revision</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-extra-slide" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-tv fa-fw"></i> Slide Mode</a>
                </li>
                
                <li class="divider"></li>
                <li class="dropdown-header">Export</li>
                <li role="presentation"><a role="menuitem" class="ui-save-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
                </li>
                
                <li role="presentation"><a role="menuitem" class="ui-save-gist" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-github fa-fw"></i> Gist</a>
                </li>
                
                
                
                <li class="divider"></li>
                <li class="dropdown-header">Import</li>
                <li role="presentation"><a role="menuitem" class="ui-import-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-import-gist" href="#" data-toggle="modal" data-target="#gistImportModal"><i class="fa fa-github fa-fw"></i> Gist</a>
                </li>
                
                <li role="presentation"><a role="menuitem" class="ui-import-clipboard" href="#" data-toggle="modal" data-target="#clipboardModal"><i class="fa fa-clipboard fa-fw"></i> Clipboard</a>
                </li>
                <li class="divider"></li>
                <li class="dropdown-header">Download</li>
                <li role="presentation"><a role="menuitem" class="ui-download-markdown" tabindex="-1" href="#" target="_self"><i class="fa fa-file-text fa-fw"></i> Markdown</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-download-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> HTML</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-download-raw-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> Raw HTML</a>
                </li>
            </ul>
        </li>
    </ul>
</div>

<div class="container-fluid text-center">
    <div class="vertical-center-row">
        <h1>500 Internal Error <small>wtf.</small></h1>
    </div>
</div>

⥅ node [[st]] pulled by Agora

📓 garden/flancian/St.md by @flancian

a [[town]].
- in [[Switzerland]].

📓 garden/flancian/st.md by @flancian

a [[person]].
- I met someone tonight!
- I have the feeling we'll be [[friends]].

[[2022-08-31]]

[[agora doc]]
- Thank you so much for the review and feedback! [[go/agora doc]]
[[revolution]] and [[global reform]]
- [[tracy chapman]] uses revolution as standing for [[empowerment]]
  - [[heaven's here on earth]]
- Start small, build for one person, built an island of [[positive deviation]]
- Bottom up approach is preferable over grand visions (paraphrasing)
- [[st]] some "wasted" time in her past on grand visions
  - [[global reform]] doesn't seem doable
  - think globally, act locally
  - build alternatives
  - how to define [[better]]
- [[institute for the future]]
- there's 'argue against', 'push back' and other relatively negatively framed
- #push [[paulo freire]]
  - [[problem setting]] ~ [[problem posing]]
  - education is the resistance, it is [[empowerment]]
- [[revolution]] vs [[evolution]]
  - #push [[jihad]]
    - [[greater jihad]] ~ fighting with yourself to be better
    - [[smaller jihad]] ~ fighting others
- #push [[dual power]]
  - [[parallel polis]]
- #push [[mitchel resnick]]
  - "[[scratch]] is an [[agora]] for [[children]]"
- #push [[funding]] open source projects
  - [[outreachy]]
  - [[topcoder]] [[thrive]] https://www.topcoder.com/thrive
    - [[500 words]] articles
- #push [[python]]
  - [[networkx]] https://en.wikipedia.org/wiki/NetworkX

[[2022-08-19]]

Greetings!
- How are we?
[[Grant]] running until end of August.
- Around [[edtech]].
- Can pivot (in this last stretch) to bounties.
#push [[interledger]]
- project used for [[web monetization]]
- used for transferring between sponsors and contributors

⥅ node [[sts]] pulled by Agora

📓 garden/neil/sts.md by @neil

STS

Sometimes [[Science, technology and society]], sometimes [[Science and technology studies]].

Critical studies of the impact of science and technology on society.

Technology and society

technologies are the product not only of technical work but also of social negotiations

– [[Cybernetic Revolutionaries]]

technologies are not value-neutral but rather are a product of the historical contexts in which they are made

– [[Cybernetic Revolutionaries]]

Technologies are historical texts. When we read them, we are able to read history

– [[Cybernetic Revolutionaries]]

political innovation can spur technological innovation.

– [[Cybernetic Revolutionaries]]

technology can shape the path of political history by making certain actions possible

– [[Cybernetic Revolutionaries]]

historical readings of technology can make visible the complexities internal to a political project

– [[Cybernetic Revolutionaries]]

⥅ node [[tc]] pulled by Agora

📓 garden/flancian/tc.md by @flancian

Tc

[[pull]] [[tech crunch]]

⥅ node [[tei]] pulled by Agora

📓 garden/flancian/tei.md by @flancian

Tei

https://tei-c.org/

⥅ node [[tfm]] pulled by Agora

📓 garden/flancian/tfm.md by @flancian

<removed>

⥅ node [[tfp]] pulled by Agora

📓 garden/flancian/tfp.md by @flancian

a [[project]].
- [[work]]

⥅ node [[tft]] pulled by Agora

📓 garden/flancian/tft.md by @flancian

[[pull]] [[tools for thought]]

⥅ node [[tid]] pulled by Agora

📓 garden/flancian/tid.md by @flancian

tid

a [[format]]
- [[tiddler]]
- [[tiddlywiki]] [[node server]]

⥅ node [[tie]] pulled by Agora

📓 garden/melanocarpa/xo.tal/tie.jpg by @melanocarpa

⥅ node [[tla]] pulled by Agora

📓 garden/flancian/tla.md by @flancian

tla+

tla+ and tla get the same note I guess due to limitations with how [[foam]] handles special characters.
"If you're interested in TLA+ I recommend https://learntla.com which uses the simpler notation PlusCal" -- from a [[hn]] comment in https://news.ycombinator.com/item?id=26385075.

⥅ node [[tlc]] pulled by Agora

📓 stoa/doc.anagora.org/tlc.md by @anonymous@doc.anagora.org

<title>500 Internal Error wtf.

<link rel="stylesheet" href="https://doc.anagora.org/css/center.css">

New
Publish
Extra
Revision
Slide Mode

            <li class="divider"></li>
            <li class="dropdown-header">Export</li>
            <li role="presentation"><a role="menuitem" class="ui-save-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
            </li>
            
            <li role="presentation"><a role="menuitem" class="ui-save-gist" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-github fa-fw"></i> Gist</a>
            </li>
            
            
            
            <li class="divider"></li>
            <li class="dropdown-header">Import</li>
            <li role="presentation"><a role="menuitem" class="ui-import-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-import-gist" href="#" data-toggle="modal" data-target="#gistImportModal"><i class="fa fa-github fa-fw"></i> Gist</a>
            </li>
            
            <li role="presentation"><a role="menuitem" class="ui-import-clipboard" href="#" data-toggle="modal" data-target="#clipboardModal"><i class="fa fa-clipboard fa-fw"></i> Clipboard</a>
            </li>
            <li class="divider"></li>
            <li class="dropdown-header">Download</li>
            <li role="presentation"><a role="menuitem" class="ui-download-markdown" tabindex="-1" href="#" target="_self"><i class="fa fa-file-text fa-fw"></i> Markdown</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-download-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> HTML</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-download-raw-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> Raw HTML</a>
            </li>
            <li class="divider"></li>
            <li role="presentation"><a role="menuitem" class="ui-help" href="#" data-toggle="modal" data-target=".help-modal"><i class="fa fa-question-circle fa-fw"></i> Help</a>
            </li>
        </ul>
        <a class="btn btn-link ui-mode">
            <i class="fa fa-pencil"></i>
        </a>
    </div>
</div>
<div class="collapse navbar-collapse">
    <ul class="nav navbar-nav navbar-form navbar-left" style="padding:0;">
        <div class="btn-group" data-toggle="buttons">
            <label class="btn btn-default ui-view" title="View (Ctrl+Alt+V)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-eye"></i>
            </label>
            <label class="btn btn-default ui-both" title="Both (Ctrl+Alt+B)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-columns"></i>
            </label>
            <label class="btn btn-default ui-edit" title="Edit (Ctrl+Alt+E)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-pencil"></i>
            </label>
        </div>
        <div class="btn-group" data-toggle="buttons">
            <label class="btn ui-night" title="Night Theme">
                <input type="checkbox" name="night"><i class="fa fa-moon-o"></i>
            </label>
        </div>
        <span class="btn btn-link btn-file ui-help" title="Help" data-toggle="modal" data-target=".help-modal">
            <i class="fa fa-question-circle"></i>
        </span>
    </ul>
    <ul class="nav navbar-nav navbar-right">
        <li id="online-user-list">
            <a class="ui-status" data-toggle="dropdown">
                <span class="label label-danger"><i class="fa fa-plug"></i> OFFLINE</span>
            </a>
            <ul class="dropdown-menu list" role="menu" aria-labelledby="menu" style="right: 15px;width: 200px;">
            </ul>
        </li>
    </ul>
    <ul class="nav navbar-nav navbar-right" style="padding:0;">
        <li>
            <a href="https://doc.anagora.org/new" target="_blank" rel="noopener" class="ui-new">
                <i class="fa fa-plus"></i> New
            </a>
        </li>
        <li>
            <a href="#" target="_blank" rel="noopener" class="ui-publish">
                <i class="fa fa-share-square-o"></i> Publish
            </a>
        </li>
        <li>
            <a data-toggle="dropdown">
                Menu <i class="fa fa-caret-down"></i>
            </a>
            <ul class="dropdown-menu list" role="menu" aria-labelledby="menu">
                <li class="dropdown-header">Extra</li>
                <li role="presentation"><a role="menuitem" class="ui-extra-revision" tabindex="-1" data-toggle="modal" data-target="#revisionModal"><i class="fa fa-history fa-fw"></i> Revision</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-extra-slide" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-tv fa-fw"></i> Slide Mode</a>
                </li>
                
                <li class="divider"></li>
                <li class="dropdown-header">Export</li>
                <li role="presentation"><a role="menuitem" class="ui-save-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
                </li>
                
                <li role="presentation"><a role="menuitem" class="ui-save-gist" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-github fa-fw"></i> Gist</a>
                </li>
                
                
                
                <li class="divider"></li>
                <li class="dropdown-header">Import</li>
                <li role="presentation"><a role="menuitem" class="ui-import-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-import-gist" href="#" data-toggle="modal" data-target="#gistImportModal"><i class="fa fa-github fa-fw"></i> Gist</a>
                </li>
                
                <li role="presentation"><a role="menuitem" class="ui-import-clipboard" href="#" data-toggle="modal" data-target="#clipboardModal"><i class="fa fa-clipboard fa-fw"></i> Clipboard</a>
                </li>
                <li class="divider"></li>
                <li class="dropdown-header">Download</li>
                <li role="presentation"><a role="menuitem" class="ui-download-markdown" tabindex="-1" href="#" target="_self"><i class="fa fa-file-text fa-fw"></i> Markdown</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-download-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> HTML</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-download-raw-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> Raw HTML</a>
                </li>
            </ul>
        </li>
    </ul>
</div>

<div class="container-fluid text-center">
    <div class="vertical-center-row">
        <h1>500 Internal Error <small>wtf.</small></h1>
    </div>
</div>

⥅ node [[tom]] pulled by Agora

📓 garden/neil/tom.md by @neil

Tom

⥅ node [[ton]] pulled by Agora

📓 garden/neil/ton.md by @neil

Ton

Ton is a [[person]] whom I met via the [[IndieWeb]]. He co-hosted [[IWC Utrecht]].

[[Open data]]. [[Networked agency]].

https://zylstra.org

⥅ node [[tor]] pulled by Agora

📓 garden/neil/tor.md by @neil

Tor

⥅ node [[tpb]] pulled by Agora

📓 garden/flancian/tpb.md by @flancian

tpb

a [[site]]
- [[pull]] [[the pirate bay]]
- [[go]] https://thepiratebay.org
  - might be blocked in some countries

⥅ node [[tpu]] pulled by Agora

📓 garden/KGBicheno/Artificial Intelligence/Introduction to AI/Week 3 - Introduction/Definitions/Tpu.md by @KGBicheno

TPU

Go back to the [[AI Glossary]]

#TensorFlow #GoogleCloud

Abbreviation for Tensor Processing Unit.

⥅ node [[ttl]] pulled by Agora

📓 garden/flancian/ttl.md by @flancian

ttl

A runnable node that tries to return [[turtle]], [[rdf]] representing the given [[node]] or [[context]].
- https://anagora.org/run/ttl returns turtle for the whole agora.
- https://anagora.org/run/ttl/stoa returns turtle relevant for the node [[stoa]] in particular.
[[push]] [[do]]
- [[implement]]
  - Plan
    - use [[rdflib]]

https://twitter.com/flancian/status/1379895535340040198

⥅ node [[ttm]] pulled by Agora

📓 garden/flancian/ttm.md by @flancian

#go https://dainty-sable-264aa3.netlify.app/

⥅ node [[twg]] pulled by Agora

📓 garden/flancian/twg.md by @flancian

a [[working group]].
- #pull [[social coop tech group]]
- #go https://meet.mayfirst.org/social-coop-tech
- #meet https://meet.mayfirst.org/social-coop-tech
- [[minutes]] https://www.loomio.com/d/UwAeiBgE/tech-meeting-minutes
- [[wiki]] https://git.coop/social.coop/tech/operations/-/wikis/home
- [[calendar]] https://share.mayfirst.org/remote.php/dav/calendars/flancian/social-coop_shared_by_socialcoop/
- [[bugs]] https://git.coop/social.coop/tech/operations/-/issues
- [[chat]] https://matrix.to/#/#socialcoop-tech:matrix.org
- [[agenda]] https://doc.anagora.org/social-coop-tech-group
- #push [[social coop tech group]]
  - #push [[projects]]
    - #push [[mastodon upgrade]]
      - [[restores]]
      - [[experiments server]] ~ [[secondary server]]
        
        working on this the weekend of [[2022-11-19]] :)
      - [[hometown]]

📓 stoa/doc.anagora.org/twg.md by @anonymous@doc.anagora.org

<title>500 Internal Error wtf.

<link rel="stylesheet" href="https://doc.anagora.org/css/center.css">

New
Publish
Extra
Revision
Slide Mode

            <li class="divider"></li>
            <li class="dropdown-header">Export</li>
            <li role="presentation"><a role="menuitem" class="ui-save-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
            </li>
            
            <li role="presentation"><a role="menuitem" class="ui-save-gist" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-github fa-fw"></i> Gist</a>
            </li>
            
            
            
            <li class="divider"></li>
            <li class="dropdown-header">Import</li>
            <li role="presentation"><a role="menuitem" class="ui-import-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-import-gist" href="#" data-toggle="modal" data-target="#gistImportModal"><i class="fa fa-github fa-fw"></i> Gist</a>
            </li>
            
            <li role="presentation"><a role="menuitem" class="ui-import-clipboard" href="#" data-toggle="modal" data-target="#clipboardModal"><i class="fa fa-clipboard fa-fw"></i> Clipboard</a>
            </li>
            <li class="divider"></li>
            <li class="dropdown-header">Download</li>
            <li role="presentation"><a role="menuitem" class="ui-download-markdown" tabindex="-1" href="#" target="_self"><i class="fa fa-file-text fa-fw"></i> Markdown</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-download-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> HTML</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-download-raw-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> Raw HTML</a>
            </li>
            <li class="divider"></li>
            <li role="presentation"><a role="menuitem" class="ui-help" href="#" data-toggle="modal" data-target=".help-modal"><i class="fa fa-question-circle fa-fw"></i> Help</a>
            </li>
        </ul>
        <a class="btn btn-link ui-mode">
            <i class="fa fa-pencil"></i>
        </a>
    </div>
</div>
<div class="collapse navbar-collapse">
    <ul class="nav navbar-nav navbar-form navbar-left" style="padding:0;">
        <div class="btn-group" data-toggle="buttons">
            <label class="btn btn-default ui-view" title="View (Ctrl+Alt+V)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-eye"></i>
            </label>
            <label class="btn btn-default ui-both" title="Both (Ctrl+Alt+B)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-columns"></i>
            </label>
            <label class="btn btn-default ui-edit" title="Edit (Ctrl+Alt+E)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-pencil"></i>
            </label>
        </div>
        <div class="btn-group" data-toggle="buttons">
            <label class="btn ui-night" title="Night Theme">
                <input type="checkbox" name="night"><i class="fa fa-moon-o"></i>
            </label>
        </div>
        <span class="btn btn-link btn-file ui-help" title="Help" data-toggle="modal" data-target=".help-modal">
            <i class="fa fa-question-circle"></i>
        </span>
    </ul>
    <ul class="nav navbar-nav navbar-right">
        <li id="online-user-list">
            <a class="ui-status" data-toggle="dropdown">
                <span class="label label-danger"><i class="fa fa-plug"></i> OFFLINE</span>
            </a>
            <ul class="dropdown-menu list" role="menu" aria-labelledby="menu" style="right: 15px;width: 200px;">
            </ul>
        </li>
    </ul>
    <ul class="nav navbar-nav navbar-right" style="padding:0;">
        <li>
            <a href="https://doc.anagora.org/new" target="_blank" rel="noopener" class="ui-new">
                <i class="fa fa-plus"></i> New
            </a>
        </li>
        <li>
            <a href="#" target="_blank" rel="noopener" class="ui-publish">
                <i class="fa fa-share-square-o"></i> Publish
            </a>
        </li>
        <li>
            <a data-toggle="dropdown">
                Menu <i class="fa fa-caret-down"></i>
            </a>
            <ul class="dropdown-menu list" role="menu" aria-labelledby="menu">
                <li class="dropdown-header">Extra</li>
                <li role="presentation"><a role="menuitem" class="ui-extra-revision" tabindex="-1" data-toggle="modal" data-target="#revisionModal"><i class="fa fa-history fa-fw"></i> Revision</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-extra-slide" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-tv fa-fw"></i> Slide Mode</a>
                </li>
                
                <li class="divider"></li>
                <li class="dropdown-header">Export</li>
                <li role="presentation"><a role="menuitem" class="ui-save-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
                </li>
                
                <li role="presentation"><a role="menuitem" class="ui-save-gist" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-github fa-fw"></i> Gist</a>
                </li>
                
                
                
                <li class="divider"></li>
                <li class="dropdown-header">Import</li>
                <li role="presentation"><a role="menuitem" class="ui-import-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-import-gist" href="#" data-toggle="modal" data-target="#gistImportModal"><i class="fa fa-github fa-fw"></i> Gist</a>
                </li>
                
                <li role="presentation"><a role="menuitem" class="ui-import-clipboard" href="#" data-toggle="modal" data-target="#clipboardModal"><i class="fa fa-clipboard fa-fw"></i> Clipboard</a>
                </li>
                <li class="divider"></li>
                <li class="dropdown-header">Download</li>
                <li role="presentation"><a role="menuitem" class="ui-download-markdown" tabindex="-1" href="#" target="_self"><i class="fa fa-file-text fa-fw"></i> Markdown</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-download-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> HTML</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-download-raw-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> Raw HTML</a>
                </li>
            </ul>
        </li>
    </ul>
</div>

<div class="container-fluid text-center">
    <div class="vertical-center-row">
        <h1>500 Internal Error <small>wtf.</small></h1>
    </div>
</div>

⥅ node [[ty]] pulled by Agora

📓 garden/flancian/ty.md by @flancian

ty

a [[person]]

⥅ node [[tío]] pulled by Agora

📓 garden/flancian/tío.md by @flancian

[[20 de abril]] / [[23 de abril]] de [[1947]]

⥅ node [[ubi]] pulled by Agora

📓 garden/flancian/ubi.md by @flancian

Ubi

[[pull]] [[universal basic income]]
[[give directly]] https://www.givedirectly.org/ubi-study/
- [[go]] [[give directly]]
- in favour
  - [[utopia for realists]]
  - great potential to reduce suffering for many
  - can have greatly progressive effects but still be backed by fiscal conservatives
- against
  - https://twitter.com/CkLorentzen/status/1383386895573344257

📓 garden/vera/ubi.md by @vera

[[universal basic income]]

⥅ node [[ufw]] pulled by Agora

📓 garden/neil/ufw.md by @neil

ufw

⥅ node [[ui]] pulled by Agora

📓 garden/flancian/ui.md by @flancian

ui

Flancia is a [[game]], and every computer game has a [[ui]].
- The Agora is 90s looking, partly on purpose, partly due to lack of [[time]] :)
- I admire the [[hacker ethos]] so I don't mind [[things]] which are nerdy/old school/[[y2k]] looking.
- But I'd love to improve the UI to make it more [[usable]] and [[accessible]].
- [[pull]] [[ux]]
  - the [[agora]] should be [[diverse]] and [[inclusive]].

⥅ node [[un]] pulled by Agora

📓 garden/flancian/un.md by @flancian

UN

[[pull]] [[united nations]]
The closest we have to [[global governance]].

⥅ node [[us]] pulled by Agora

📓 garden/flancian/us.md by @flancian

us

[[If I made a go for it]], would you come with [[me]]?
- [[yes]] [[no]] [[maybe]]

⥅ node [[usd]] pulled by Agora

📓 garden/vera/USD.md by @vera

United States Dollar

⥅ node [[uv]] pulled by Agora

📓 garden/flancian/uv.md by @flancian

#go https://docs.astral.sh/uv/getting-started/installation/
- curl -LsSf https://astral.sh/uv/install.sh | sh

⥅ node [[uxn]] pulled by Agora

📓 garden/melanocarpa/uxn.myco by @melanocarpa

Uxn is a small virtual computer by [[100 rabbits]]. It is often said it is core of Varvara, but I'm not exactly sure what is the difference, so I will talk about both here.

The Uxn ecosystem is a personal computing playground, created to host small tools and games, programmable in its own unique assembly language.

It was designed with an implementation-first mindset with a focus on creating portable graphical applications, the distribution of Uxn projects is akin to sharing game roms for any classic console emulator.

=> https://100r.co/site/uxn.html => https://wiki.xxiivv.com/site/uxn.html

[[Devine Lu Linvega]] [[said]]:

rest assured that learning Uxn will have absolutely no value whatsoever on your resume.

=> links>uxn

= Uxn and me => uxnerie

I first discovered Uxn in 2022, after long hesitation. => uxn 2022-03-27

The summer of the same year I held a series of streams, where I learned [[Uxntal]], the assembly language of Uxn. => summer stream 2022

= The keyboard toots Devine, is the CMD/WIN/SUPER key supported by VARVARA? It's definitely not in Controller/button.

it's no,

Ctrl => A Alt => B Shift => Select Home => Start

yeah cool. Not gonna find any windows keys on the IBM PC keyboard anyway. img { https://s3.eu-central-1.wasabisys.com/lor-sh/lor-sh/media_attachments/files/108/908/193/582/831/241/original/9956d0776d52df9c.png { An IBM PC keyboard. It lacks the WIN key. }}

or, on the NDS XD

⥅ node [[vc]] pulled by Agora

📓 garden/flancian/vc.md by @flancian

[[pull]] [[video conference]]
[[pull]] [[venture capital]]

⥅ node [[vgr]] pulled by Agora

📓 garden/bmann/_notes/vgr.md by @bmann

Venkatesh Rao, of Ribbon Farm and many other things.

Twitter @vgr

📓 garden/flancian/vgr.md by @flancian

VGR

A [[person]] on [[twitter]]: https://twitter.com/vgr.
Highly appreciated by some of my contacts.
Sometimes a bit too self-assured? But what do I know -- perhaps it's all warranted.

⥅ node [[vim]] pulled by Agora

📓 garden/jakeisnt/pages/vim.md by @jakeisnt

(Neo)Vim can handle multithreading properly - unlike Emacs - but otherwise Emacs feels far more extensible. The keybinding innovations - mostly taken from `ed` - and macro system make manipulating files an incredibly productive process. Vim users often have a library of cli and tui programs that they use in conjunction with Vim to facilitate a desktop ecosystem without a GUI.

Learn the keybindings! These standards work everywhere.

If you can install things on your system - and want to use an expressive cli text editor - use neovim. It runs faster, is more expressive, and supports built-in modern tooling for systems like the language-server protocol and tree-sitter for robust and performant syntax highlighting.

Cheat Sheets!

Shortcuts

Evaluation of Leader keys

Comma: As it should always be followed with a space grammatically, every other key can be freely mapped to with no delay! You lose the functionality of backwards repeating though…
Space: What doom emacs uses. My current key and what I'm used to. This works fine, but the timeout definitely can impact the fluency of writing on occasion.
Semicolon: Interesting option, but there seem to be some strange repeat patterns in specific modes.
Escape: Controversial, it's pretty far away… but it's the default. Unclear whether bashing the pinkie to the right is a great motion (just like Emacs and the left).

📓 garden/karlicoss/soft/vim.md by @karlicoss

[[{~} Switch case of letter]] [[habit]]
[[fast navigation in string]]
[[{t} search before character]] [[habit]]
[use * and # for searching current word](#sndfrsrchngcrrntwrd TIDDLYLINK) [[habit]] [[vim]]
[[vim-like apps]]
- [https://www.reddit.com/r/vim/comments/3tluqr/my_list_of_applications_with_vi_keybindings/](#swwwrddtcmrvmcmmntstlqrmylstfpplctnswthvkybndngs TIDDLYLINK)
- [[https://xaizek.github.io/2016-08-13/big-list-of-vim-like-software/]]
[2020-11-04] Vim Tips for the Intermediate Vim User | Jemma Issroff [[vim]]

{~} Switch case of letter [[habit]]

fast navigation in string

press ft (find char 't')
then ; to repeat forward
, to repeat backwards

{t} search before character [[habit]]

use * and # for searching current word [[habit]] [[vim]]

vim-like apps

https://www.reddit.com/r/vim/comments/3tluqr/my_list_of_applications_with_vi_keybindings/

https://xaizek.github.io/2016-08-13/big-list-of-vim-like-software/

`[2020-11-04]` Vim Tips for the Intermediate Vim User | Jemma Issroff [[vim]]

⥅ node [[vk]] pulled by Agora

📓 garden/melanocarpa/vk.myco by @melanocarpa

VK, short for //vkontakte//, which is based on Russian for //in contact//, is a Russian [[social network]], which is also the most successful on the market. It is a good notion to not use it.

= Links => https://t.me/roguelike_theory/431

Сделал скрипт для бекапа паблика. Он качает тексты, комментарии и картинки, сохраняет их в JSON и рендерит в Markdown. Очень советую это сделать, если вы тоже паблик ведете! Пока это оч сырая штука – написал буквально за пару часов по вдохновению – но я планирую доработать и помочь всем, кто тоже хочет свой архив паблика в VK сохранить как-то: [[https://github.com/valyagolev/leave-vk]]

=> https://github.com/alcortazzo/vktgbot

Telegram Bot on Python for reposting from VKontakte community pages (group, public page or event page) to Telegram Channels. Согласно [[этому посту]], на этом боте работает канал [[Decentralize!]]

=> https://mastodon.ml/@uu/108074104532584675 | @uu@mastodon.ml 2022-04-04

Возможно, мало кто помнит, но я расскажу. Однажды ВК был немного лучшим местом. У них был нормальный xmpp api! Можно было подрубиться к серверу любым клиентом и пользоваться сообщениями, чем я невозбранно пользовался на нокии e90 с qwerty клавой. Было [хорошо]. Было это еще до того, как Дуров выпилил стену, если память не изменяет.

⥅ node [[vr]] pulled by Agora

📓 garden/karlicoss/vr.md by @karlicoss

[[Vr visualise plots?]] [[think]]
[[Try to visualise quantum harmonic oscillator]] [[viz]] [[physics]]
[[World with negative curvature simulation? Maybe even hyperbolic]] [[viz]] [[math]] [[physics]]
[2019-02-13] HARFANG® 3D [[python]]
[2019-02-01] Singularity Hacker - Your Virtual Reality Shortlist [[ar]] [[gadget]]
- [2019-02-01] shit, discontinued…
[[wonder if I could represent timeline somehow]] [[memex]] [[timeline]]
[[Render 4d sphere]] [[viz]]
- [2019-05-06] and then do same for cube, for instance
[[hmm, looks like no quantum physics simulations in VR? I could totally plot something interesting…]] [[quantum]] [[viz]]
[2019-06-15] jeromeetienne/AR.js: Efficient Augmented Reality for the Web - 60fps on mobile! [[ar]]
[2019-07-27] Non-euclidean virtual reality - YouTube [[physics]] [[viz]] [[math]]
[2019-06-01] Joshua Corvinus (@JoshuaCorvinus) | Twitter
[2019-06-28] First day Valve Index, Loving it already! And using it to its max potential, obviously : virtualreality
[2019-11-10] The Electric Brain - Mind Field S2 (Ep 8) - YouTube [[eyetracking]]
[2019-12-12] Visakan Veerasamy on Twitter: "Can’t wait to have AR glasses that sync with @roamresearch so that every object in my house can be tagged and networked" / Twitter [[ar]]
[[Openvr?]]
[[https://webxr.io/webar-playground/]] [[ar]]
[2019-06-18] Real-Time Facial Tracking in VR : virtualreality
[[Can I use vr for drill? Some visual clue?]] [[vr]] [[spacedrep]]
[2019-08-13] Modeled in VR (oculusmedium, quill), rendered in Unity with a toonshader. /r/virtualreality
[2019-06-06] I made an augmented reality real time sudoku solver in Python (source code in comments) /r/Python [[ar]]
[2019-06-18] Non-euclidean virtual reality - YouTube [[towatch]] [[vr]]
[2019-06-18] What does VR reveal about the 4th dimension? - YouTube [[towatch]] [[vr]]
[2019-06-18] Non-euclidean virtual reality using ray marching - YouTube [[towatch]] [[vr]]
[2019-06-18] Chroma Lab - VR Physics Simulation Sandbox - YouTube [[towatch]] [[vr]]
[2020-10-31] Show HN: What would mechanical programming look like? [[vr]]
[2019-04-08] Arcan is a powerful development framework for creating virtually anything between user interfaces for specialised embedded applications all the way to full-blown standalone desktop environments [[vr]] [[interface]]
- [2019-07-23] One of the absolute main goals with the Arcan project as a whole is to explore different models for all the technical aspects that goes into how we interact with computers, and to provide the infrastructure for reducing the barrier to entry for such explorations.
- [2019-07-23] ok it's interesting, but not sure what it's got for me now
[2020-05-19] Oculus: Hand Tracking Updates | Hacker News [[vr]]
[2020-05-19] YORB 2020 [[vr]]
[[matplotvr for a project name?]] [[vr]] [[viz]]
[2019-07-27] Non-euclidean virtual reality using ray marching - YouTube https://www.youtube.com/watch?v=ivHG4AOkhYA&list=WL&index=51
[[I recorded my life with camera glasses for an entire year and made a VR app that lets me explore my memories in a beautiful memory palace! Each sphere is a 10 second memory :)]] [[lifelogging]] [[vr]]

Vr visualise plots? [[think]]

Try to visualise quantum harmonic oscillator [[viz]] [[physics]]

World with negative curvature simulation? Maybe even hyperbolic [[viz]] [[math]] [[physics]]

`[2019-02-13]` HARFANG® 3D [[python]]

https://www.harfang3d.com/
from awesome-python

`[2019-02-01]` Singularity Hacker - Your Virtual Reality Shortlist [[ar]] [[gadget]]

http://singularityhacker.com/post/70342744357/your-virtual-reality-shortlist

4. Myo
Sooo you’re walking around a virtual world and your mind is being blown. Eventually you’re going to want to reach out and interact with it. The Myo controllers are your in-game fine motor skills.

hmm could use it for kinda mouse? that'd be pretty cool, basically controlling mouse without moving hands from the keyboard

`[2019-02-01]` shit, discontinued…

wonder if I could represent timeline somehow [[memex]] [[timeline]]

Render 4d sphere [[viz]]

Maybe make an online game where you have to guess the radius (you can leave markers)
Basically the idea is you can mark the pole and walk around it
Kinda binary search!

`[2019-05-06]` and then do same for cube, for instance

hmm, looks like no quantum physics simulations in VR? I could totally plot something interesting… [[quantum]] [[viz]]

`[2019-06-15]` jeromeetienne/AR.js: Efficient Augmented Reality for the Web - 60fps on mobile! [[ar]]

https://github.com/jeromeetienne/AR.js

`[2019-07-27]` Non-euclidean virtual reality - YouTube [[physics]] [[viz]] [[math]]

https://www.youtube.com/watch?v=ztsi0CLxmjw&list=WL&index=50
ok, that's pretty interesting, they demonstrate parallel transport

`[2019-06-01]` Joshua Corvinus (@JoshuaCorvinus) | Twitter

https://twitter.com/JoshuaCorvinus

[2019-06-11] some AR/VR guy?
[2019-08-13] followed

`[2019-06-28]` First day Valve Index, Loving it already! And using it to its max potential, obviously : virtualreality

https://www.reddit.com/r/virtualreality/comments/c6jbxk/first_day_valve_index_loving_it_already_and_using/

First day Valve Index, Loving it already! And using it to its max potential, obviously

`[2019-11-10]` The Electric Brain - Mind Field S2 (Ep 8) - YouTube [[eyetracking]]

https://www.youtube.com/watch?v=NXNGvDdkXZE&list=PLZRRxQcaEjA7wmh3Z6EQuOK9fm1CqnJCI&index=8
some pretty cool eye tracking device for locked in syndrome in 23:30

`[2019-12-12]` Visakan Veerasamy on Twitter: "Can’t wait to have AR glasses that sync with @roamresearch so that every object in my house can be tagged and networked" / Twitter [[ar]]

https://twitter.com/visakanv/status/1205001027386138624

Visakan Veerasamy
@visakanv
Can’t wait to have AR glasses that sync with @roamresearch
 so that every object in my house can be tagged and networked

Openvr?

SteamVR/OpenVR. It's fantastic.

https://webxr.io/webar-playground/ [[ar]]

`[2019-06-18]` Real-Time Facial Tracking in VR : virtualreality

https://www.reddit.com/r/virtualreality/comments/bsyaxs/realtime_facial_tracking_in_vr/

Can I use vr for drill? Some visual clue? [[vr]] [[spacedrep]]

`[2019-08-13]` Modeled in VR (oculusmedium, quill), rendered in Unity with a toonshader. /r/virtualreality

`[2019-06-06]` I made an augmented reality real time sudoku solver in Python (source code in comments) /r/Python [[ar]]

`[2019-06-18]` Non-euclidean virtual reality - YouTube [[towatch]] [[vr]]

https://www.youtube.com/watch?v=ztsi0CLxmjw

`[2019-06-18]` What does VR reveal about the 4th dimension? - YouTube [[towatch]] [[vr]]

https://www.youtube.com/watch?v=S-yRYmdsnGs

`[2019-06-18]` Non-euclidean virtual reality using ray marching - YouTube [[towatch]] [[vr]]

https://www.youtube.com/watch?v=ivHG4AOkhYA
ray marching?

`[2019-06-18]` Chroma Lab - VR Physics Simulation Sandbox - YouTube [[towatch]] [[vr]]

https://www.youtube.com/watch?v=qu8lB3l20wY

`[2020-10-31]` Show HN: What would mechanical programming look like? [[vr]]

https://mockmechanics.com/

`[2019-04-08]` Arcan is a powerful development framework for creating virtually anything between user interfaces for specialised embedded applications all the way to full-blown standalone desktop environments [[vr]] [[interface]]

https://arcan-fe.com/about/

`[2019-07-23]` One of the absolute main goals with the Arcan project as a whole is to explore different models for all the technical aspects that goes into how we interact with computers, and to provide the infrastructure for reducing the barrier to entry for such explorations.

`[2019-07-23]` ok it's interesting, but not sure what it's got for me now

`[2020-05-19]` Oculus: Hand Tracking Updates | Hacker News [[vr]]

Don’t forget if you install Virtual Desktop you can play all your PCVR games wirelessly on it too. I play HL Alyx like this and it’s flawless.

`[2020-05-19]` YORB 2020 [[vr]]

matplotvr for a project name? [[vr]] [[viz]]

`[2019-07-27]` Non-euclidean virtual reality using ray marching - YouTube https://www.youtube.com/watch?v=ivHG4AOkhYA&list=WL&index=51

I recorded my life with camera glasses for an entire year and made a VR app that lets me explore my memories in a beautiful memory palace! Each sphere is a 10 second memory :) [[lifelogging]] [[vr]]

https://redd.it/lg7wcn

📓 garden/vera/vr.md by @vera

[[virtual reality]]

⥅ node [[vrm]] pulled by Agora

📓 garden/vera/vrm.md by @vera

[[3d modeling]] format
[[vroid]]

⥅ node [[vue]] pulled by Agora

📓 garden/neil/vue.md by @neil

Vue

Projects that I like that make use of Vue

iznik-nuxt (powers [[Freegle]] front-end)
[[Karrot]] (community food sharing)
kinopio (https://pketh.org/how-kinopio-is-made)
YunoHost admin
Pixelfed (federated photo sharing)
Some parts of Nextcloud

Concepts

Data and props

In a nutshell:

Data is the private memory of each component where you can store any variables you need. Props are how you pass this data from a parent component down to a child component.

– Props Versus Data in Vue: The Subtle Differences You Need to Know - Michael T…

That whole article is a handy overview of the difference between the two: https://michaelnthiessen.com/vue-props-vs-data/

Reactivity

This is to me so far the nicest thing about using Vue. You worry about state and logic, and the view is rendered dynamically without having to toggle bits of the DOM all over the place.

With Vue you don't need to think all that much about when the component will update itself and render new changes to the screen.

This is because Vue is reactive.

Instead of calling setState every time you want to change something, you just change the thing! As long as you're updating a reactive property (props, computed props, and anything in data), Vue knows to watch for when it changes.

– Props Versus Data in Vue: The Subtle Differences You Need to Know - Michael T…

Vuex

Vuex is based to some degree on the Elm architecture.

Most user interface bugs are state-related. Not a surprise when you consider that UI is one big concurrency problem. User interaction, animation, and asynchronous processes such as http requests, all happen constantly within a UI, returning who knows when, interleaving with each other, and mutating state. It’s terribly easy for these processes to step on each other’s toes and produce a broken app states.

– ObservableStore - by Gordon Brander - Subconscious

⥅ node [[war]] pulled by Agora

📓 garden/forshaper/notes/pages/war.md by @forshaper

"To be a successful [[soldier]] you must know history. Read it objectively–dates and even the minute details of tactics are useless. What you must know is how man reacts. [[Weapons]] change but man who uses them changes not at all. To win battles you do not beat weapons–you beat the [[soul]] of man of the enemy man. To do that you have to destroy his weapons, but that is only incidental. You must read biography and especially [[autobiography]]. If you will do it you will find that war is [[simple]]. Decide what will hurt the [[enemy]] most within the limits of your capabilities to harm him and then do it. TAKE CALCULATED RISKS. That is quite different from being rash. " [[Patton]]
To move along the line of natural [[expectation]] consolidates the [[opponent]]'s [[equilibrium]].
[[Weapons]] cannot fight without men, but men can fight without weapons.
Women in war collapsed:: true
- Deborah Sampson: disguised as man to serve in Continental Army
- They Fought Like Demons: American Civil War
- Lt. Ashley White and Cpt. Jennifer Moreno, died as cultural support
- Mary Jennings Hegar
- Danger Close by Amber Smith
The more [[relaxed]] you are, the harder it is for your [[opponent]] to sense, anticipate, and [[block]] your next [[attack]].
SUMO MOSES collapsed:: true
- Surprise Unity Mobility Offense
- Mass Objective Security Economy of Force Simplicity
"Mutual [[trust]] is the surest basis of [[discipline]] in necessity and [[danger]]."
When you must give an [[order]], use landmarks instead of a [[map]] (wherever possible).
Cultivate decisive action.
Hinder your [[enemy]]'s [[range]] of [[motion]] rather than trying to crush them totally.
[[Conviction]] is seeing actual paths to your end.
[[Fit]] your [[ends]] to your [[means]].
Direct [[conflict]] does allow for [[decisive]] [[victory]] only because of how it changes the viewer's [[perception]].
Never [[fight]] except when you [[choose]].
[[Phalanx]] only wins on flat open [[ground]].
It is not the [[big]] armies that [[win]] [[battle]]s, it is the [[good]] ones.
instead of 'being' in combat, most followers of [[styles]] 'do' combat.
If you follow an established [[system]], you are learning the system. You are not learning [[yourself]].
Truth is [[relationship]] with the [[enemy]]: constantly [[moving]] and [[alive]]. Never static. collapsed:: true
- Do not [[select]] or [[reject]]; hang on to no thoughts. If you are clear and simple, you never have to choose.
From the [[old,]] [[security]]. From the [[new]], [[flow]].
To [[understand]] combat, approach it simply and directly. collapsed:: true
- Understanding requires continuous [[awareness]].
When [[hit]], [[move]] and fire.
[[Tanks]] have [[angle]] of fire limitations that are up and down as well, not just left and right.
FIRST, MOBILIZE YOUR [[WILL]]: directives from the Russian side of the Chechen war.
1. Always maintain your [[authority]]. -Patronizing means you're [[weak]] -to affect authority means you have no authority
2. Don't [[steal]] from your people.
3. Be [[fair]]/predictable.
4. Reward the local when they do something aligned with you.
5. Display a sense of calm and self-worth.
6. Never beat a Chechen. Do not humiliate. Do not abuse. You will only embitter them.
7. Do not insult their women.
8. Do not blame the one in front of you for the last attack you suffered.
9. Study their culture.
10. You are always at war. The one in front of you may not be on your side. Win them.
[[Hug]]ging is the practice of staying 50-200m of the enemy to avoid close range fire support. This is similar to being 'in the pocket' in [[boxing]] or [[MMA]].
De[[moral]]ize the [[enemy]] before you get to them so that the [[fight]] is over before it starts.
If the [[enemy]] has an [[immobilized]] [[part]] that is between its[[main body]] and its [[base]], drive toward that part so that the main body is disconnected from the base. [[move]]

⥅ node [[way]] pulled by Agora

📓 garden/flancia.org/pages/way.md by @flancia.org

Flancia is a set of simple algorithms. They run, not in a computer (not for now anyway), but somewhere else. In our minds.

It is, that is, a set of ideas -- like any other. Some are instructions, some are concepts. Some are true and some are false. I try to write only ideas that have some interesting probability to be true -- but I can only do my best. I'm sure a lot of bad ideas are around here; it is up to you to decide. I make no pretense of being perfect, that should be clear enough.

How do you build an utopia? Behind every problem there is a simple solution -- often an incomplete one.

To live in an utopia, first you agree with others on what an utopia is. Then you look for it around you. If what you see is not that utopia, you work with others on a plan to change the world -- some part of the world, to begin with -- into it. The plan can start simple, but you should add details later: like how to get the material resources to bankroll the utopia, and what do you do with people that have other ideas of an utopia than you. If you get the resources and enough people collaborate with you, you build it. Then you move there.

Flancia is the middle way: perhaps everybody over X should donate 50%.

The internet makes it possible to cut the middle man. Give money directly to others using your own principles. Just give it to other actual beings. It's up to you.

Flancia is the internet (a new tool) plus buddhism (an old tool).

⥅ node [[we]] pulled by Agora

📓 garden/flancian/we.md by @flancian

we

[[You]] and [[me]], my friend.
#pull Imagine an internet with [[wikilinks everywhere]]

⥅ node [[web]] pulled by Agora

📓 garden/jakeisnt/pages/web.md by @jakeisnt

Things about the web.

How do we design a "healthy" site?

What is a healthy site?

Chromium's Web Vitals is a Google initiative to log a variety of information about a website served over the internet, particularly to assess the website's behavior and efficiency in Google Chrome. The library offers an easy-to-use way to disseminate performance to a series of values, locally or in CI, that can then be tracked and reported.

Visions

Xanadu is Ted Nelson's dream of a hyperconnected world.

Interesting Specifications

Webmentions

Webmentions are ways to notify URLs when their sites are mentioned, helping construct a more social web; this notifies some publisher B when website A links their site, so that they can backlink to it!

Unfortunately, this protocol isn't standardized - but it's fun : ).

How To Create An IndieWeb Profile - Kev Quirk
getting started on the indieweb, a series of protocols constructed around the traditional web to promote greater interaction.

Do not

Use ads

Should I Block Ads?

web hostility

article "Facebook is at odds with the open web that I love and defend…" Netscape Navigator (small internet) -> big internet! The modern web is being destroyed – personalized content, growth hacking, social media activation, CMS and user experience. These websites are not built to appreciate the visitor – they are constructed to make the user a customer. Cookies bad! Small blogging good!

How do browsers work?

Good question! Here is a good article.

SEO

how seo is ruining the web Google's vaguely worded SEO advice handbook Can we reverse-engineer SEO with big data, lots of time, and search results? Is this just one neural network vs. another producing nondeterminism?

Alternatives

DNS

Beehive: CoDoNS is an alternative DNS server with a better distribution profile while offering backwards compatibility. Handshake - A Namespace For The Decentralized Web is an article pleading for an actual, decentralized namespace - the ICANN licensing system just isn't cutting it. Handshake uses a decentralized blockchain to register, track and resolve unique domain names with proof of work - this is not dissimilar to ENS.

Serving

Planktos allows users to serve content from users directly to other users by cacheing static files as a torrent. It's a cool peer-to-peer system that can cache both simple and complex static sites!

⥅ node [[why]] pulled by Agora

📓 garden/evan/Why.md by @evan

Why what? Why the digital garden in contrast to social media, to to a blog; like the whole world has agreed upon? Or, why write [[near everything]] in such a way so that the whole world may view? These two questions are separable, but not separate, so they are answered together in one page.

I choose to share my mind in this form because it is the closest to the medium I exist in. We don't live in a list, and certainly not [[in a higherarchy]], but rather in a collection of interconnected ideas. When you choose to sort your written thought by list, you quickly become disconnected. How does one talk about a side idea not worthy of another post in conventional systems? Conventionally, by bloating a idea (read: blog post) with non relevant information. Similarly, when ommiting parts of thought (to avoid the bloat discussed), you loose the opportunity to share and elaborate on thought.

Additionally, in systems such as social media that encourage ommision, the full story is never told. If (as you often might want to) you wish to recover closed thought, you must note it in a different location; and soon a reoccurring struggle rises from the inherit impossibility of distributing thought perfectly across multiple locations (remember our friend - [[the higherarchy problem]].

For my sake, the majority of what I write is public in a digital garden. In this way I

never need to deal with mismatches of public and private data
never need to consider if I should ommit or include, I simply write in another location.
show the world a view of me 100% in my control.

Utilities

HideIt: shows a window by its name when a cursor is a defined region on the screen
DispUtils: provides utilities for getting information about displays
wmutils: tools for X window manipulation. These can be used to script your own window manager!
autorandr automatically detects the current display and loads the appropriate X window setup.
https://github.com/salman-abedin/devour is a script to open a tool created by a terminal on top of the terminal rather than allowing the terminal to waste space. This is a cool idea and makes the system feel smoother - but it might be more interesting to see the output in some way while viewing the result of the command in an ergonomic, notebook-like way! Some terminals with web rendering capabilities are working on these visualizations, but they've been done since smalltalk, really.

Cool ideas

I want to be able to have a computing environment that's both local-first and accessible from anywhere. I don't always have an internet connection, so I want my information readily available, but on occasion I only have access to an arbitrary device - where the only guarantee I have is that the device has a web browser. My system should work within these constraints!

share your terminal as a web application

Cool WM projects

WindowChef: a stacking window manager
Sara WM: the best features of DWM and BSPWM
2BWM: A fast, floating WM with two borders
goowmwm: get out of my way! simple and effective window manager.
bug.n is a tiling window manager for Windows written in AutoHotkey.
https://github.com/conformal/spectrwm fun tiling wm
StumpWM is interesting insofar as its behavior is runtime modifiable using Common Lisp. I'm not sure how far this goes or to what degree people want to be able to modify their window manager - it's not something that strikes me as particularly flexible, but it might be nice to have such a system to work with during development of a WM.

WM Reviews

BSPWM

ideas : changing the classname by identification in the bspwm tree!
' sticky' scratchpad : will switch monitors only if the desktop is swapped with the other monitor. personal policy - 'scratchbad when opened occupies the biggest window'
sticky normal terminal window (with tmux, via byobu) to the scratchpad is much more useful and allows for a single terminal window to be kept open rather than having to use many

https://www.reddit.com/r/unixporn/comments/1jubyi/arch_bspwm_never_going_back_to_xmonad/ read on this!

http://thedarnedestthing.com/bspwm idea : have window actions focus and place the window on the main window of the target desktop.

a swap monitor action is very cool; may want to either retain or swap monitor focus independent of this! depending on the direction of the hotkey relative to the monitor which has focus.if key action points to opposite monitor, swap the desktop moving the focus with the desktop; else, retain focus on the current monitor while cycling the desktop

toggling the dock! this is much more distraction free (through conky) as opposed to a continuously updating status line at the top or bottom of the screen. conky is super beautiful and configuring it would besuper useful. run conky above the desktop windows via xdotool as per sdothum's articles

this seems like the most useful and powerful way to go in terms of a system configuration. make sure to use this one in the future.

herbstluftwm

http://thedarnedestthing.com/herbstluftwm things it can do: (see sdothum here: http://thedarnedestthing.com/herbstluftwm%20workflow)

dynamic window placement to balance frames
dynamic window focus to avoid empty frame focus on application close
distraction free monocle layout proportions (versus fullscreen mode)
automatic desktop layout restore on focus and monitor swap*
quick monitor and frame swapping with focus directions
hide/unhide windows per desktop
pulsating borders to indicate overlapped windows
virtual monitors to show/hide the conky system information panel
single status bar to follow monitor focus and hint monitor geometry width
blur background if a window is present on the desktop

note that monitor geometries are global when set. honestly his explanation is pretty complicated: there are a lot of things that can be done without this complex configuration.

can have a status bar that follows the monitor focus! killing the status bar isn't super effective, but using xdotool to manage the visibility of the panels seems muh more palatable

check out his dotfiles for more information on this: http://thedarnedestthing.com/herbstluftwm%20juggling

XMonad

cool because it is written in and configured with haskell. this is another manual tiling window manager; you have to manually align and manage tiles.

idea : rather than manually moving the window in between panels, shifting all of the workspaces 'one to the right' or 'one to the left' to refocus the panel u want at the center seems super valuable! this means that u dont have to reconfigure all of the stuff displayed at any given time) not sure if this is worthwhile as opposed to other things : bspwm doesn't do anything other than window management, unlike other programs that may not integrate very well into the existing shell.

benefits:

extensive multimonitor support
stable and feature rich
easy to configure and extend

drawbacks:

huge
fractured into many different libraries
terrible floating layer that cannot always be avoided
using haskell (though this is also a pro?)

The rEFInd boot menu and it's super slow as it has to load of the images from BIOS - not a good experience. It's fine to show logs as your computer starts up.

things to integrate

whatever side manager that sdothum uses in lieu of the header interface
a terminal email client
better notification daemon
unifying chat app? (slack/signal/discord/irc(????) frontend somehow)
twitter ? (may not want to browse twitter at all …)

stream video over terminal or smth

⥅ node [[wp]] pulled by Agora

📓 garden/flancian/wp.md by @flancian

Wp

#pull [[wikipedia]]
- in [[yubnub]] 'wp' indicates a Wikipedia search
- [[Wikipedia]] has great [[lists]] so many lists in the Agora are [[pulled]] from them.

⥅ node [[wus]] pulled by Agora

📓 garden/flancian/wus.md by @flancian

Wus

[[pull]] [[world university and school]] [[wuas]]

⥅ node [[x-l]] pulled by Agora

📓 garden/flancian/x l.md by @flancian

a [[person]].
- [[googler]]

⥅ node [[xiq]] pulled by Agora

📓 garden/flancian/xiq.md by @flancian

a [[person]].
- [[friend]]
- knows about [[machine learning]], [[ai]], [[moloch]].
- [[agora]] https://anagora.org/@xiq
- ([[flancia collective]] is likely not my party, but more generally a guild space I meet as often as I can.)
  - I wonder why I wrote this here? Maybe it came up in conversation with [[xiq]]?

⥅ node [[yes]] pulled by Agora

📓 garden/flancian/yes.md by @flancian

Yes

(Read [[viral]] first if you haven't. The children of this paragraph can be considered a virus. If you don't want to catch it, please stop reading now.)
Welcome to [[Flancia]]! It is, I hope, a place interesting to all [[kind]] people.
- Whatever happens, I hope you're having a great day or night, wherever [[you]] are.
- If you can, have [[a nice day]]!
- Note that [[Flancia]] is a complex of memes. You can think of reading Flancia as being akin to be fine with being infected; thank you for taking the risk with this if you do.
- Flancia is meant to be [[fully optional]].
  - If you don't like Flancia, you can stop thinking of Flancia anytime. You will always remain a friend to our hearts, as of the time we parted. Unless you want to be forgotten; if you'd like to be forgotten, please just let it be known.
  - This is a device designed such as it's fine if you just ignore it. You can stop reading this anytime :)
- Having said that, I hope you like this complex! It tries to be wholly positive; it is meant to be a [[constructive]] subset of knowledge.
  - In Flancia there is an [[Agora]] that you can visit anytime if you are so inclined.
  - It is reachable through the internet.
  - If you don't currently have internet access, but can reach out to [[flancia collective]] and we will try to secure [[internet rights]] for you. We have limited resources but can at least try to help you find people that can help you better than we currently can.
- What is encoded in your most popular [[meme]]?
  - The one in [[viral]], I guess, is mine; currently my most popular post on social media. I may be remembered for it if I don't do any better before I die.
  - I'd rather be remembered for a better thing, though, which is why I started [[Flancia]].
  - Which of you would you like to share? Tell me over [[matrix]] and I'll read you gladly.
- In Flancia [[you]] and [[I]] both can join a [[gentle revolution]].

⥅ node [[you]] pulled by Agora

📓 garden/flancian/you.md by @flancian

You: my [[friend]], my [[reader]].
- Thank you for being here.
- [[Flancia]] is yours. It is [[free]] and [[open source]]. It is my gift to you. Make of it what you will.
  - In [[Flancia]] there is an [[Agora]]!

📓 garden/flancian/You.md by @flancian

My [[dear reader]]!

Thank you for being here. It's been long since I wrote to you directly, although in a way everything I write is for you -- inasmuch you are interested in particular [[pieces]] :).

⥅ node [[ywa]] pulled by Agora

📓 garden/flancian/ywa.md by @flancian

⥅ node [[ywx]] pulled by Agora

📓 garden/flancian/ywx.md by @flancian

#pull [[yoga with x]]
#go https://anagora.org/yoga-with-x

⥅ node [[zig]] pulled by Agora

📓 garden/s5bug/zig.md by @s5bug

Zig

https://ziglang.org/
A [[programming language]].

⥅ node [[zk]] pulled by Agora

📓 garden/flancian/zk.md by @flancian

zk

a [[tool]].
- [[command line]] [[zettelkasten]]
- pairs well with [[vim]], [[vscode]]
- [[go]] https://github.com/mickael-menu/zk

📓 stoa/doc.anagora.org/zk.md by @anonymous@doc.anagora.org

<title>500 Internal Error wtf.

<link rel="stylesheet" href="https://doc.anagora.org/css/center.css">

New
Publish
Extra
Revision
Slide Mode

            <li class="divider"></li>
            <li class="dropdown-header">Export</li>
            <li role="presentation"><a role="menuitem" class="ui-save-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
            </li>
            
            <li role="presentation"><a role="menuitem" class="ui-save-gist" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-github fa-fw"></i> Gist</a>
            </li>
            
            
            
            <li class="divider"></li>
            <li class="dropdown-header">Import</li>
            <li role="presentation"><a role="menuitem" class="ui-import-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-import-gist" href="#" data-toggle="modal" data-target="#gistImportModal"><i class="fa fa-github fa-fw"></i> Gist</a>
            </li>
            
            <li role="presentation"><a role="menuitem" class="ui-import-clipboard" href="#" data-toggle="modal" data-target="#clipboardModal"><i class="fa fa-clipboard fa-fw"></i> Clipboard</a>
            </li>
            <li class="divider"></li>
            <li class="dropdown-header">Download</li>
            <li role="presentation"><a role="menuitem" class="ui-download-markdown" tabindex="-1" href="#" target="_self"><i class="fa fa-file-text fa-fw"></i> Markdown</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-download-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> HTML</a>
            </li>
            <li role="presentation"><a role="menuitem" class="ui-download-raw-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> Raw HTML</a>
            </li>
            <li class="divider"></li>
            <li role="presentation"><a role="menuitem" class="ui-help" href="#" data-toggle="modal" data-target=".help-modal"><i class="fa fa-question-circle fa-fw"></i> Help</a>
            </li>
        </ul>
        <a class="btn btn-link ui-mode">
            <i class="fa fa-pencil"></i>
        </a>
    </div>
</div>
<div class="collapse navbar-collapse">
    <ul class="nav navbar-nav navbar-form navbar-left" style="padding:0;">
        <div class="btn-group" data-toggle="buttons">
            <label class="btn btn-default ui-view" title="View (Ctrl+Alt+V)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-eye"></i>
            </label>
            <label class="btn btn-default ui-both" title="Both (Ctrl+Alt+B)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-columns"></i>
            </label>
            <label class="btn btn-default ui-edit" title="Edit (Ctrl+Alt+E)">
                <input type="radio" name="mode" autocomplete="off"><i class="fa fa-pencil"></i>
            </label>
        </div>
        <div class="btn-group" data-toggle="buttons">
            <label class="btn ui-night" title="Night Theme">
                <input type="checkbox" name="night"><i class="fa fa-moon-o"></i>
            </label>
        </div>
        <span class="btn btn-link btn-file ui-help" title="Help" data-toggle="modal" data-target=".help-modal">
            <i class="fa fa-question-circle"></i>
        </span>
    </ul>
    <ul class="nav navbar-nav navbar-right">
        <li id="online-user-list">
            <a class="ui-status" data-toggle="dropdown">
                <span class="label label-danger"><i class="fa fa-plug"></i> OFFLINE</span>
            </a>
            <ul class="dropdown-menu list" role="menu" aria-labelledby="menu" style="right: 15px;width: 200px;">
            </ul>
        </li>
    </ul>
    <ul class="nav navbar-nav navbar-right" style="padding:0;">
        <li>
            <a href="https://doc.anagora.org/new" target="_blank" rel="noopener" class="ui-new">
                <i class="fa fa-plus"></i> New
            </a>
        </li>
        <li>
            <a href="#" target="_blank" rel="noopener" class="ui-publish">
                <i class="fa fa-share-square-o"></i> Publish
            </a>
        </li>
        <li>
            <a data-toggle="dropdown">
                Menu <i class="fa fa-caret-down"></i>
            </a>
            <ul class="dropdown-menu list" role="menu" aria-labelledby="menu">
                <li class="dropdown-header">Extra</li>
                <li role="presentation"><a role="menuitem" class="ui-extra-revision" tabindex="-1" data-toggle="modal" data-target="#revisionModal"><i class="fa fa-history fa-fw"></i> Revision</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-extra-slide" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-tv fa-fw"></i> Slide Mode</a>
                </li>
                
                <li class="divider"></li>
                <li class="dropdown-header">Export</li>
                <li role="presentation"><a role="menuitem" class="ui-save-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
                </li>
                
                <li role="presentation"><a role="menuitem" class="ui-save-gist" tabindex="-1" href="#" target="_blank" rel="noopener"><i class="fa fa-github fa-fw"></i> Gist</a>
                </li>
                
                
                
                <li class="divider"></li>
                <li class="dropdown-header">Import</li>
                <li role="presentation"><a role="menuitem" class="ui-import-dropbox" tabindex="-1" href="#" target="_self"><i class="fa fa-dropbox fa-fw"></i> Dropbox</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-import-gist" href="#" data-toggle="modal" data-target="#gistImportModal"><i class="fa fa-github fa-fw"></i> Gist</a>
                </li>
                
                <li role="presentation"><a role="menuitem" class="ui-import-clipboard" href="#" data-toggle="modal" data-target="#clipboardModal"><i class="fa fa-clipboard fa-fw"></i> Clipboard</a>
                </li>
                <li class="divider"></li>
                <li class="dropdown-header">Download</li>
                <li role="presentation"><a role="menuitem" class="ui-download-markdown" tabindex="-1" href="#" target="_self"><i class="fa fa-file-text fa-fw"></i> Markdown</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-download-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> HTML</a>
                </li>
                <li role="presentation"><a role="menuitem" class="ui-download-raw-html" tabindex="-1" href="#" target="_self"><i class="fa fa-file-code-o fa-fw"></i> Raw HTML</a>
                </li>
            </ul>
        </li>
    </ul>
</div>

<div class="container-fluid text-center">
    <div class="vertical-center-row">
        <h1>500 Internal Error <small>wtf.</small></h1>
    </div>
</div>

⥅ node [[znc]] pulled by Agora

📓 garden/neil/znc.md by @neil

znc

Set it up March 2020.

Didn't seem to want to connect via [[ERC]] when SSL was enabled. I'll need to go back and try that.

resources: http://notes.secretsauce.net/notes/2014/10/08_znc-and-erc.html

⥅ node [[zo]] pulled by Agora

📓 garden/flancian/zo.md by @flancian

a [[cooperative]].
- #go https://zo.team/
- working on [[open and decentralised technology]]

⥅ node [[日本]] pulled by Agora

📓 garden/evan/日本.md by @evan

⚠️ This page is about Japanese, click [[here]] for general things relating to the country